TkA05G416810 | RubberDandelionOmics

Gene overview

TkA05G416810

Reference: TK1151 Chr: Chr05 Coordinates: 103757226-103758476 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

801 bp · TkA05G416810|TK1151|cDNA

GATTCTATTCCCACATGTTTTCTGGAACCTATCACCGGCTACAAGACATTCATTCACATAATTCAGACACAGAAAACGAGAGAGCAATTCAAAGAAGAAATAAAAAAATTCGTCAACAATGGGGAAAGATTTGAGCGATGAACAAGTTTCCGCCATGAAAGAGGCCTTTACCCTCTTCGATACCGATGGCGATGGCAAGATCGCCCCATCGGAGCTCGGGATTCTCATGCGTTCTCTCGGCGGAAATCCAACGCAAGCGC...

CDS

Download CDS FASTA

444 bp · TkA05G416810|TK1151|CDS

ATGGGGAAAGATTTGAGCGATGAACAAGTTTCCGCCATGAAAGAGGCCTTTACCCTCTTCGATACCGATGGCGATGGCAAGATCGCCCCATCGGAGCTCGGGATTCTCATGCGTTCTCTCGGCGGAAATCCAACGCAAGCGCAGCTCAAGTCCATAATCGCCGAAGAAAAACTCACCTCTCCTTTTGATTTCAACAGGTTTACGGACCTGATGGGTAAGCACCTCAAACCAGAGCCCTTTGATCGCCAGCTTCGTGATGC...

Protein

Download Protein FASTA

147 aa · TkA05G416810|TK1151|PROTEIN

MGKDLSDEQVSAMKEAFTLFDTDGDGKIAPSELGILMRSLGGNPTQAQLKSIIAEEKLTSPFDFNRFTDLMGKHLKPEPFDRQLRDAFKVIDKDGTGFVVVADLKHILTSIGEKLEPAEFDEWIREIDVGSDGKIKYEDFIARMVAK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G416810`
TK1151 ID	TkA05G416810
OH-1004 ID	LXL04_012015
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.600
Protein coverage (%)	TK1151 92.517 / OH-1004 91.892 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G416810

Location Chr05:103757226-103758476 (+)

Description Similar to CML13: Probable calcium-binding protein CML13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12310`	Potential calcium sensor.	No verified direct reference in this release
`At1g62820`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0117400`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012015 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019722 calcium-mediated signaling Biological Process

GO:0071548 response to dexamethasone Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016460 myosin II complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0030234 enzyme regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G12310

ath:AT1G62820

ath:AT5G21274

dosa:Os08g0117400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.751

Rank 1 · TkA05G416810 · TK1151

Nucleus0.230

Rank 2 · TkA05G416810 · TK1151

Cell membrane0.100

Rank 3 · TkA05G416810 · TK1151

Endoplasmic reticulum0.063

Rank 4 · TkA05G416810 · TK1151

Mitochondrion0.047

Rank 5 · TkA05G416810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03672UPF01541-15 aa

PF13833EF-hand_85-29 aa

PF25825SAPC2_N5-32 aa

PF25530EF-hand_SWAP70_N5-41 aa

PF21008AIF-17-58 aa

PF05042Caleosin10-59 aa

PF13499EF-hand_711-55 aa

PF23564EF-hand_FSTL111-48 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G416810	`PF03672`	UPF0154	1	15	0.31	11.7
TkA05G416810	`PF13833`	EF-hand_8	5	29	8.8e-12	45.3
TkA05G416810	`PF25825`	SAPC2_N	5	32	4.5e-06	27.2
TkA05G416810	`PF25530`	EF-hand_SWAP70_N	5	41	0.034	14.9
TkA05G416810	`PF21008`	AIF-1	7	58	4.1e-07	31.1
TkA05G416810	`PF05042`	Caleosin	10	59	0.015	15.9
TkA05G416810	`PF13499`	EF-hand_7	11	55	8e-26	90.9
TkA05G416810	`PF23564`	EF-hand_FSTL1	11	48	0.024	15.7
TkA05G416810	`PF13405`	EF-hand_6	13	41	3.5e-19	67.3
TkA05G416810	`PF00036`	EF-hand_1	13	40	3.2e-17	61.5
TkA05G416810	`PF13202`	EF-hand_5	14	35	1.1e-08	34.9
TkA05G416810	`PF14658`	EF-hand_9	15	52	3.8e-09	37.6
TkA05G416810	`PF29176`	Allatotropin-like_C	20	39	0.032	14.5
TkA05G416810	`PF30551`	CFAP251_C	25	127	5.7e-06	26.8
TkA05G416810	`PF03672`	UPF0154	32	54	0.31	11.7
TkA05G416810	`PF23564`	EF-hand_FSTL1	62	78	0.024	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AZ4`	Arabidopsis thaliana	sp\|Q94AZ4\|CML13_ARATH Probable calcium-binding protein CML13	87.800%	Swiss-Prot	High
`Q8VZ50`	Arabidopsis thaliana	sp\|Q8VZ50\|CML14_ARATH Probable calcium-binding protein CML14	83.800%	Swiss-Prot	High
`Q84VG0`	Oryza sativa subsp. japonica	sp\|Q84VG0\|CML7_ORYSJ Probable calcium-binding protein CML7	75.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card