TkA05G416620 | RubberDandelionOmics

Gene overview

TkA05G416620

Reference: TK1151 Chr: Chr05 Coordinates: 103692230-103696816 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2347 bp · TkA05G416620|TK1151|cDNA

AGAACAGAGACTATTTCTGTTATTTAGTCTTAACGTGTGCAAAAGTGCTCAAATTCATTATTCACAGAATTACATGAAGTCAAATCGGACACGTGACGCGGTTATTTCAAAATTGATTCAAGTGTGATCCATCGTTTATAATTGAATCACAAATCTATATATTCTTTTCCTGTAGTTTCTTTTCGCCTCTCACGGTTCGCATAAATCTCCTCTTCCTTCTTTCCGTGCAATCGTATCGCGCTATTTCATCCGGTCCATTG...

CDS

Download CDS FASTA

1416 bp · TkA05G416620|TK1151|CDS

ATGGGATTGGGTTCCCCTAAATCAATGGCTGCATATCCAAAGAAACTTTTACCAATAGCAGCTTCAGTAGGGGGACTTGCCTTGTTCTTAATTTTTGCCTCTTTGCTTCTTGTATATCAGCCAATTGGATCTAAAGTTAGTGGCTACTTTTATAACCTAGATCAAGCTAGCAAAACCACGTTATCACCCTTTAATAATGATCCAAGCATATTTGAGATCAGGGTTAATGATACAGAAACAGATAGAAAAATTGTTGATTC...

Protein

Download Protein FASTA

471 aa · TkA05G416620|TK1151|PROTEIN

MGLGSPKSMAAYPKKLLPIAASVGGLALFLIFASLLLVYQPIGSKVSGYFYNLDQASKTTLSPFNNDPSIFEIRVNDTETDRKIVDSGTDNTVDSGINNAADSDAKKTIDSDTNKTIGSDIDKTADSVVNKTIDSDINKTFDSDTNKTIDSVIDKTVDSVVNKTIDSDTKKTTESDINKTVDSGIDKITESDINKTVDLDINKTADTNTKKSVDPGCDLYDGKWVHDSIGPLYTNNSCPVLTQMQNCQGNGRPDKDYENW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G416620`
TK1151 ID	TkA05G416620
OH-1004 ID	LXL04_021705
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.500
Protein coverage (%)	TK1151 81.953 / OH-1004 68.276 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G416620

Location Chr05:103692230-103696816 (+)

Description Similar to TBL18: Protein trichome birefringence-like 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25360`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g51640`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At4g11090`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At1g70230`	Xyloglucan acetyltransferase that catalyzes the acetylation of fucosylated Gal residues on xyloglucan side chains.	O-acetylation of Arabidopsis hemicellulose xyloglucan requires AXY4 or AXY4L, proteins with a TBL and DUF231 domain.2011 · DOI: 10.1105/tpc.111.091728 Xyloglucan O-acetyltransferases from Arabidopsis thaliana and Populus trichocarpa catalyze acetylation of fucosylated galactose residues on xyloglucan side chains.2018 · DOI: 10.1007/s00425-018-2972-0

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021705 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010150 leaf senescence Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G70230

ath:AT4G11090

ath:AT4G25360

ath:AT5G51640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.301

Rank 1 · TkA05G416620 · TK1151

Extracellular0.228

Rank 2 · TkA05G416620 · TK1151

Endoplasmic reticulum0.141

Rank 3 · TkA05G416620 · TK1151

Cell membrane0.115

Rank 4 · TkA05G416620 · TK1151

Lysosome / Vacuole0.093

Rank 5 · TkA05G416620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30843CCDC886-214 aa

PF13839PC-Esterase156-172 aa

PF14416PMR5N216-268 aa

PF24536NXPE4_C262-335 aa

PF13839PC-Esterase269-391 aa

PF21035CCDC138_C284-364 aa

PF14416PMR5N379-387 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G416620	`PF30843`	CCDC8	86	214	0.015	14.7
TkA05G416620	`PF13839`	PC-Esterase	156	172	5.6e-36	125.7
TkA05G416620	`PF14416`	PMR5N	216	268	4.3e-22	78.9
TkA05G416620	`PF24536`	NXPE4_C	262	335	0.011	16.0
TkA05G416620	`PF13839`	PC-Esterase	269	391	5.6e-36	125.7
TkA05G416620	`PF21035`	CCDC138_C	284	364	0.0031	17.4
TkA05G416620	`PF14416`	PMR5N	379	387	4.3e-22	78.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYS5`	Arabidopsis thaliana	sp\|Q8VYS5\|TBL18_ARATH Protein trichome birefringence-like 18	73.400%	Swiss-Prot	Low
`Q9FHM0`	Arabidopsis thaliana	sp\|Q9FHM0\|TBL17_ARATH Protein YLS7	72.200%	Swiss-Prot	Low
`O82509`	Arabidopsis thaliana	sp\|O82509\|TBL23_ARATH Protein trichome birefringence-like 23	44.700%	Swiss-Prot	Low
`O04523`	Arabidopsis thaliana	sp\|O04523\|TBL27_ARATH Xyloglucan O-acetyltransferase 1	43.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card