TkA05G415140 | RubberDandelionOmics

Gene overview

TkA05G415140

Reference: TK1151 Chr: Chr05 Coordinates: 103264277-103266599 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1078 bp · TkA05G415140|TK1151|cDNA

ATACGATATGACTTGTTATAACAACTTTTTCATTAACCATTTTAATTAAAATCATATTTCATTTCTATTTATAAACGGGAACCCTTTATAAATTACATTTTCCAAACAGAACTTGGTAGAGATGACTTTCGTCTGTAGGGCAAGTGGATAATGAGAAAAGCCGTATAAAATACGAGCAGTACCAATAATCTTTTCGTGAAACAACCGTCAACCACCGTCCACCGGCGATCTTCACGCCGCCGTCTCAACAACGTCATCGC...

CDS

Download CDS FASTA

507 bp · TkA05G415140|TK1151|CDS

ATGAGCCGTAGAAGAGGTGTTAGATGGGATGAAGCGAACATTGGTGAAATCGAAGCGAATAAACCAATAAGACAGAAAATCACAGAACCCAAAACTCCATATCATCCAATGGTCGATGTTGATGGATCTTTATCTCCTATTCGAAGCTCTAGTAGTTTCCTAGAAGGAGATAACAACAACAATAACAGTAACAATAACAATAACAATAACAATGCAGTTAATGCTGAAGCTATTCGCTCTGCATTAAACGAAGTGGCAAT...

Protein

Download Protein FASTA

168 aa · TkA05G415140|TK1151|PROTEIN

MSRRRGVRWDEANIGEIEANKPIRQKITEPKTPYHPMVDVDGSLSPIRSSSSFLEGDNNNNNSNNNNNNNNAVNAEAIRSALNEVAIASSSNPHSGWTSSDDESDAMDEDDDEGGKKSASFKEKRKAHYDEYRKVKELQKKDGKEMNENEKRSIVDGVGDIDIADVAH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G415140`
TK1151 ID	TkA05G415140
OH-1004 ID	LXL04_035276
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	53.100
Protein coverage (%)	TK1151 95.238 / OH-1004 89.205 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G415140

Location Chr05:103264277-103266599 (+)

Description Similar to I-2: Protein phosphatase inhibitor 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52200`	Inhibitor of protein-phosphatase 1 (PP1).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035276 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009966 regulation of signal transduction Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0009536 plastid Cellular Component

GO:0004864 protein phosphatase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT5G52200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.610

Rank 1 · TkA05G415140 · TK1151

Nucleus0.431

Rank 2 · TkA05G415140 · TK1151

Cell membrane0.110

Rank 3 · TkA05G415140 · TK1151

Mitochondrion0.048

Rank 4 · TkA05G415140 · TK1151

Golgi apparatus0.038

Rank 5 · TkA05G415140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04979IPP-27-149 aa

PF06524NOA3626-124 aa

PF22038PRC2_EED_ins55-86 aa

PF05053Menin56-133 aa

PF12722Hid156-153 aa

PF22575Vir1p58-105 aa

PF10500SR-2559-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G415140	`PF04979`	IPP-2	7	149	8.3e-25	88.7
TkA05G415140	`PF06524`	NOA36	26	124	5.4	7.0
TkA05G415140	`PF22038`	PRC2_EED_ins	55	86	0.046	14.5
TkA05G415140	`PF05053`	Menin	56	133	1.1	8.2
TkA05G415140	`PF12722`	Hid1	56	153	4.3	6.1
TkA05G415140	`PF22575`	Vir1p	58	105	1.7	7.0
TkA05G415140	`PF10500`	SR-25	59	151	0.44	10.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTK0`	Arabidopsis thaliana	sp\|Q9LTK0\|IPP2_ARATH Protein phosphatase inhibitor 2	48.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card