TkA05G415130 | RubberDandelionOmics

Gene overview

TkA05G415130

Reference: TK1151 Chr: Chr05 Coordinates: 103262128-103263129 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

706 bp · TkA05G415130|TK1151|cDNA

AATTAATCCCCCAAATCAGTCGAACACTCCAAAGCTTTAGCGAACCCTAAAATCATCATTTTCTAATTCACATCTAGCAGCAAAAGAGACATGGAAATTAAATTGAAGTGTAGCTGCGGCGAAGCGAATTGCCCGGAGTGGGCAATCATCGAAGTGCAAGGCGTTGTTGAAGTTCAACCCGCTTTCCAAGAACACTTGCGAGGTCTCCAAATTGGTGTGCTCTGCCGCCCTTCTTCTCAGGAAAACTATACTTTTACTGT...

CDS

Download CDS FASTA

435 bp · TkA05G415130|TK1151|CDS

ATGGAAATTAAATTGAAGTGTAGCTGCGGCGAAGCGAATTGCCCGGAGTGGGCAATCATCGAAGTGCAAGGCGTTGTTGAAGTTCAACCCGCTTTCCAAGAACACTTGCGAGGTCTCCAAATTGGTGTGCTCTGCCGCCCTTCTTCTCAGGAAAACTATACTTTTACTGTTGGTTATCATGAATTGAGTGGGTCAAAGATCCCCATGAAGAAACCATTACTGGTATTGAAGAAGAAGATAATAAAATCTGATATGGAAAC...

Protein

Download Protein FASTA

144 aa · TkA05G415130|TK1151|PROTEIN

MEIKLKCSCGEANCPEWAIIEVQGVVEVQPAFQEHLRGLQIGVLCRPSSQENYTFTVGYHELSGSKIPMKKPLLVLKKKIIKSDMETDQNDDDDLNSSQVELEVIGIIRQRILFKTRPKALISKPQSPVKKKVTPLGAIVEKET

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G415130`
TK1151 ID	TkA05G415130
OH-1004 ID	LXL04_021668
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G415130`
Location	Chr05:103262128-103263129 (+)
Description	Similar to DDB_G0287975: Putative uncharacterized protein DDB_G0287975
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021668` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006260 DNA replication Biological Process GO:0007064 mitotic sister chromatid cohesion Biological Process GO:1900264 positive regulation of DNA-directed DNA polymerase activity Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0031390 Ctf18 RFC-like complex Cellular Component GO:0003677 DNA binding Molecular Function GO:0003689 DNA clamp loader activity Molecular Function GO:0017116 single-stranded DNA helicase activity Molecular Function
KEGG gene cross-reference	bta:618186 ddi:DDB_G0287975 hsa:54921 mmu:214987 rno:364996 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · TkA05G415130 · TK1151

Cytoplasm0.136

Rank 2 · TkA05G415130 · TK1151

Cell membrane0.019

Rank 3 · TkA05G415130 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA05G415130 · TK1151

Mitochondrion0.012

Rank 5 · TkA05G415130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09696Ctf849-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G415130	`PF09696`	Ctf8	49	119	4.9e-10	40.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card