RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G414450
Reference: TK1151 Chr: Chr05 Coordinates: 103136393-103138054 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1263 bp · TkA05G414450|TK1151|cDNA

ATGGAATCACAGTTGCACCACCCTCATGACCGCCATTACGACGACCCCCTTCATCCCGCCGGTACTGATGTTTATGAAGAACACGAACGTGGCGGAGAGACGAAATCAGCGTTGAAGAAGGTGAAAGCAAAGGTCGAAAAGTTGAAGGATTCAATTAAGCATGGCCATGGCCACCATTACGACGATGATACAAAAACCGTGAATGATTCGGCGCCGGTTAGGAGTGGGATGGTTCAACCCACTGTTATGGAAACGCCGGT...

CDS

Download CDS FASTA

1263 bp · TkA05G414450|TK1151|CDS

ATGGAATCACAGTTGCACCACCCTCATGACCGCCATTACGACGACCCCCTTCATCCCGCCGGTACTGATGTTTATGAAGAACACGAACGTGGCGGAGAGACGAAATCAGCGTTGAAGAAGGTGAAAGCAAAGGTCGAAAAGTTGAAGGATTCAATTAAGCATGGCCATGGCCACCATTACGACGATGATACAAAAACCGTGAATGATTCGGCGCCGGTTAGGAGTGGGATGGTTCAACCCACTGTTATGGAAACGCCGGT...

Protein

Download Protein FASTA

420 aa · TkA05G414450|TK1151|PROTEIN

MESQLHHPHDRHYDDPLHPAGTDVYEEHERGGETKSALKKVKAKVEKLKDSIKHGHGHHYDDDTKTVNDSAPVRSGMVQPTVMETPVLVEDLHATHSDIVDPPVRTFAEWEEEEKHGAPPPLPIAYGAHLTDLYPVSHHDYSDQGVNKEQFRGSIGKSTGMEEDPSAPNLTTTVSPANYQTKVTDPTNTGGKEAGITDVLKSFDKMRVFDEPHSKSADQNEPEVLHTGSHDQFAPEPVNNPPLDTIAANPSNPNSSYAQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G414450
TK1151 IDTkA05G414450
OH-1004 IDLXL04_011891
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)37.300
Protein coverage (%)TK1151 94.048 / OH-1004 78.435
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G414450
LocationChr05:103136393-103138054 (-)
DescriptionSimilar to LTI65: Low-temperature-induced 65 kDa protein
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011891 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006950 response to stress Biological Process
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0010150 leaf senescence Biological Process
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT5G52300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.575
Rank 1 · TkA05G414450 · TK1151
Nucleus0.283
Rank 2 · TkA05G414450 · TK1151
Cell membrane0.246
Rank 3 · TkA05G414450 · TK1151
Mitochondrion0.050
Rank 4 · TkA05G414450 · TK1151
Endoplasmic reticulum0.037
Rank 5 · TkA05G414450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23403LTI65_LTI78_N6-29 aa
PF23403LTI65_LTI78_N32-65 aa
PF23402LTI65_LTI78_NYQTKV155-211 aa
PF23402LTI65_LTI78_NYQTKV254-267 aa
PF07918CAP160262-287 aa
PF07918CAP160329-340 aa
PF23403LTI65_LTI78_N346-351 aa
PF17207MCM_OB352-383 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G414450PF23403LTI65_LTI78_N6291.6e-0525.8
TkA05G414450PF23403LTI65_LTI78_N32651.6e-0525.8
TkA05G414450PF23402LTI65_LTI78_NYQTKV1552112.7e-2279.4
TkA05G414450PF23402LTI65_LTI78_NYQTKV2542672.7e-2279.4
TkA05G414450PF07918CAP1602622872.5e-0524.6
TkA05G414450PF07918CAP1603293402.5e-0524.6
TkA05G414450PF23403LTI65_LTI78_N3463511.6e-0525.8
TkA05G414450PF17207MCM_OB3523830.2511.8
TkA05G414450PF23399LTI65_PGEED3633904e-0936.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser