TkA05G413990 | RubberDandelionOmics

Gene overview

TkA05G413990

Reference: TK1151 Chr: Chr05 Coordinates: 103024374-103027447 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1418 bp · TkA05G413990|TK1151|cDNA

GGGTCACACCACATGAGGCATGAGCAAACAGAACACGGCTATGGTTGTTGATGCGTGTGGAATGTTATGTGATAGCGGTATAGTTGATGTGTCAACATGGACTCCATGACACTCTCATATCTTCCTTCCTTTTCACTTTCCCATCAAATCCTTGTTTCAATCACACTACTTTCGACAATTCCCAAGGCTAACAACAAGAAAAGAAGATAAAATCCCTTGTTTTCCTCACAATTTTCATCTCCATACCCAAACATGTGGCT...

CDS

Download CDS FASTA

708 bp · TkA05G413990|TK1151|CDS

ATGTGGCTGTTTAGAAAACCAGGGCCATCCGGCTTCTCGCAGAACTCCACCGCCGAGCAGGTTACCGAGGGGATTGACGCCTCTGGTCTCACCGCCATTGTTACAGGAGGATCAAGTGGAATTGGCCGTGAAACAGCTCGTGTTTTAGCACTTCGTGGGGCCCATGTCGTCATGGGTGTCAGGAATATGGCCGCCGGCAAACAGGTTGAAGAAGCAATAGTGAAAGAAATCCCAACAGCTAAAGTTGAAGCAATGGAATT...

Protein

Download Protein FASTA

235 aa · TkA05G413990|TK1151|PROTEIN

MWLFRKPGPSGFSQNSTAEQVTEGIDASGLTAIVTGGSSGIGRETARVLALRGAHVVMGVRNMAAGKQVEEAIVKEIPTAKVEAMELDLNSMASVRKFASDFNSSGQSLNLLINNAGIMMTPFMLSKDNIELQFATNHLGHFLLTHLLLDNMKNTARKSKKEGRIVNVSSEAHKFPYPEGIRFDKINDEKEYSKFQAYGQSKLANILHANELSRQLKERGSRYNRKFSPSRSNLN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G413990`
TK1151 ID	TkA05G413990
OH-1004 ID	LXL04_021654
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 93.617 / OH-1004 69.401 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G413990

Location Chr05:103024374-103027447 (-)

Description Similar to TIC32: Short-chain dehydrogenase TIC 32, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23430`	Involved in protein precursor import into chloroplasts.	Tic32, an essential component in chloroplast biogenesis.2004 · DOI: 10.1074/jbc.m402817200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021654 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0030178 negative regulation of Wnt signaling pathway Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0071560 cellular response to transforming growth factor beta stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G23430

bna:106397857

mmu:80707

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.324

Rank 1 · TkA05G413990 · TK1151

Mitochondrion0.209

Rank 2 · TkA05G413990 · TK1151

Endoplasmic reticulum0.172

Rank 3 · TkA05G413990 · TK1151

Peroxisome0.134

Rank 4 · TkA05G413990 · TK1151

Nucleus0.123

Rank 5 · TkA05G413990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short31-180 aa

PF08659KR31-129 aa

PF01370Epimerase33-214 aa

PF13561adh_short_C239-174 aa

PF18584SYCP2_SLD80-165 aa

PF00106adh_short190-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G413990	`PF00106`	adh_short	31	180	1.6e-29	103.5
TkA05G413990	`PF08659`	KR	31	129	5.7e-09	36.8
TkA05G413990	`PF01370`	Epimerase	33	214	0.00011	22.4
TkA05G413990	`PF13561`	adh_short_C2	39	174	2.1e-15	57.7
TkA05G413990	`PF18584`	SYCP2_SLD	80	165	0.27	12.4
TkA05G413990	`PF00106`	adh_short	190	220	1.6e-29	103.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVM0`	Arabidopsis thaliana	sp\|A2RVM0\|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic	72.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card