TkA05G412170 | RubberDandelionOmics

Gene overview

TkA05G412170

Reference: TK1151 Chr: Chr05 Coordinates: 102531388-102536821 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2352 bp · TkA05G412170|TK1151|cDNA

TGACGGAACATTTTCCCAAAAAAGAATTCATTTCAATTTTAAAGCCAACAGTTTATTCAGGAAGTGCACTGCACTTGTGTTTTGCTACCTCTTCGATACAAACGAGAAACGGCCTCCATCATTAATCGGTGATTTCCCCAAACACACAACTTCACTCGGAAACCATCGCCCTCATCTCATAATCCACACTCCAGTCTGCAAATCATCCTCTGTTGATTTCATTTGATTTGGATCTTCGTGTTCTATCACAACATTCAATT...

CDS

Download CDS FASTA

1722 bp · TkA05G412170|TK1151|CDS

ATGGCTCAAGTTGTGGCTTCGAAGCTGACTCATAGTTCATTTGCGTGCCCTAGCTCTTCCGGTTCTCTGAACAGCCAGATTGAAAAAATCAAACCTAGCGGTTTCGCTTCCAAAGTTCTTAATGGTTATAATAATGATCAGATTAGCAAGAGACAGAACCGTGTTCTTAGCGTTAACGCAAGGAGACAGGAGGTTCAAGTTCTTCCGGTTACACCTGAAGACGTAACCAAGATAGAAAGGAATCATCAATCACCGGAAGT...

Protein

Download Protein FASTA

573 aa · TkA05G412170|TK1151|PROTEIN

MAQVVASKLTHSSFACPSSSGSLNSQIEKIKPSGFASKVLNGYNNDQISKRQNRVLSVNARRQEVQVLPVTPEDVTKIERNHQSPEVLQGDTSVGIWSRPLVKRKTKIVCTIGPSTDTKEMIWKLAEAGMNVARLNMSHGDHASHQKVIDLVKEYNAQNKDNVIAIMLDTKGPEVRSGDLPQPVNLVNGEEFTFTIKRGVGTADCVSVNYDDFVNDVEAGDMLLVDGGMMSLLVKSKTEDSVKCEVVDGGELKSRRHLNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G412170`
TK1151 ID	TkA05G412170
OH-1004 ID	LXL04_021623
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G412170

Location Chr05:102531388-102536821 (-)

Description Similar to PKP2: Plastidial pyruvate kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52920`	Required for plastidial pyruvate kinase activity.	Function of plastidial pyruvate kinases in seeds of Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03232.x
`At1g32440`	Required for plastidial pyruvate kinase activity.	No verified direct reference in this release
`At3g22960`	Required for plastidial pyruvate kinase activity.	Function of plastidial pyruvate kinases in seeds of Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03232.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021623 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0010431 seed maturation Biological Process

GO:0048316 seed development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004743 pyruvate kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G32440

ath:AT3G22960

ath:AT5G52920

nta:107822892

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.920

Rank 1 · TkA05G412170 · TK1151

Mitochondrion0.119

Rank 2 · TkA05G412170 · TK1151

Cytoplasm0.027

Rank 3 · TkA05G412170 · TK1151

Nucleus0.018

Rank 4 · TkA05G412170 · TK1151

Peroxisome0.015

Rank 5 · TkA05G412170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02887PK_C7-50 aa

PF00224PK104-424 aa

PF00478IMPDH105-156 aa

PF00150Cellulase112-166 aa

PF03328HpcH_HpaI276-343 aa

PF02887PK_C393-459 aa

PF00478IMPDH395-411 aa

PF03328HpcH_HpaI397-415 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G412170	`PF02887`	PK_C	7	50	2.3e-20	73.5
TkA05G412170	`PF00224`	PK	104	424	1.1e-111	373.8
TkA05G412170	`PF00478`	IMPDH	105	156	0.077	12.7
TkA05G412170	`PF00150`	Cellulase	112	166	0.0051	17.1
TkA05G412170	`PF03328`	HpcH_HpaI	276	343	0.11	12.5
TkA05G412170	`PF02887`	PK_C	393	459	2.3e-20	73.5
TkA05G412170	`PF00478`	IMPDH	395	411	0.077	12.7
TkA05G412170	`PF03328`	HpcH_HpaI	397	415	0.11	12.5
TkA05G412170	`PF02887`	PK_C	462	553	2.3e-20	73.5
TkA05G412170	`PF00224`	PK	513	561	1.1e-111	373.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLW9`	Arabidopsis thaliana	sp\|Q9FLW9\|PKP2_ARATH Plastidial pyruvate kinase 2	77.300%	Swiss-Prot	High
`Q93Z53`	Arabidopsis thaliana	sp\|Q93Z53\|PKP3_ARATH Plastidial pyruvate kinase 3, chloroplastic	77.500%	Swiss-Prot	High
`Q9LIK0`	Arabidopsis thaliana	sp\|Q9LIK0\|PKP1_ARATH Plastidial pyruvate kinase 1, chloroplastic	47.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card