TkA05G409740 | RubberDandelionOmics

Gene overview

TkA05G409740

Reference: TK1151 Chr: Chr05 Coordinates: 101878122-101880196 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1363 bp · TkA05G409740|TK1151|cDNA

TTGTCAAGCTCCATGATATAAATAAGTGAAGAATGTACCAACAACCATTCCAATATCATCACTACACTAATTAGGTCTCTGGGTGAGATTCTTTCCCTTCTTTTATTTCCCTTTTTGTTGTATAGTGGTGTCATCTTTTACTAGTCTTGTGATTAGGGTTTGCATAATGTGAAAAGGATTTCGCTTTTCCTCCACTAAAAGTCATCTGGGTGTGCTCTTTTTGCTTCAAAGTTTTGATCTTTCTTCACATGAGAGCAAAA...

CDS

Download CDS FASTA

843 bp · TkA05G409740|TK1151|CDS

ATGAGAGCAAAATACGAAAAGGATATTTGTTCAATGTATGCAGAAACCGGCGTAATGTTCCCTTACTTTCAGAGTTTTTCACCTGATGTTCATCAATTCGATGATCTCTGTTACTCCCAGAAACCCAATTCGTGCTTGGGTACTGTGGTTCAAAGCTCTGTTATATCAGATTACAATTTTGGGGGTGAAGGCGATCTTTTCAAAGCACCAGAACCGATAATCGAGCAGCCATTGGTTACCCTTGACGCTATGTTCATGAT...

Protein

Download Protein FASTA

280 aa · TkA05G409740|TK1151|PROTEIN

MRAKYEKDICSMYAETGVMFPYFQSFSPDVHQFDDLCYSQKPNSCLGTVVQSSVISDYNFGGEGDLFKAPEPIIEQPLVTLDAMFMISNGEDNLSSQELSVTDIGSSLQNEEFLSDVFHDYKEIETSPLSEVLNYKFPVKTDEIPIVKENVHPPGHGEIPKSVSSDCLSSMEWIHGVQMKHGVLNLKDVDFGSVYGMRRAFSEGDIKNLDNGNGSHRQPQLMSEHAMEDRWQKLSRYRNKKTKRNFGRKIKYACRKALAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G409740`
TK1151 ID	TkA05G409740
OH-1004 ID	LXL04_021597
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G409740

Location Chr05:101878122-101880196 (+)

Description Similar to COL5: Zinc finger protein CONSTANS-LIKE 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57660`	Zinc finger protein CONSTANS-LIKE 5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021597 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048571 long-day photoperiodism Biological Process

GO:0048572 short-day photoperiodism Biological Process

GO:0048576 positive regulation of short-day photoperiodism, flowering Biological Process

GO:0048577 negative regulation of short-day photoperiodism, flowering Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT5G15850

ath:AT5G57660

dosa:Os06g0275000

dosa:Os09g0240200

osa:107276161

osa:4346474

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.854

Rank 1 · TkA05G409740 · TK1151

Cytoplasm0.232

Rank 2 · TkA05G409740 · TK1151

Cell membrane0.045

Rank 3 · TkA05G409740 · TK1151

Endoplasmic reticulum0.026

Rank 4 · TkA05G409740 · TK1151

Mitochondrion0.018

Rank 5 · TkA05G409740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06203CCT230-272 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G409740	`PF06203`	CCT	230	272	1.6e-16	60.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHH8`	Arabidopsis thaliana	sp\|Q9FHH8\|COL5_ARATH Zinc finger protein CONSTANS-LIKE 5	54.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card