TkA05G408310 | RubberDandelionOmics

Gene overview

TkA05G408310

Reference: TK1151 Chr: Chr05 Coordinates: 101523338-101523958 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

582 bp · TkA05G408310|TK1151|cDNA

ATGAATTGGAACCCTAATTTAATCCTCTACACTTGCATCGCAAAAGACACAACAATTCTAGCTGAATTCAATTCAAAAGAATTCAATTCAAAAGATGAACATCTTAGCGATTTAGCTAAGAAGTGCCTGGAGAAGACGCCGCCCTTCCATTCCATCTTCTCTCACACCGTTCATGGCAAAACCTACATGTTTTTCATCCTTAATCGTTTTGTATATTTTGGAATCTTCGATGAATCGCTCGAGAAACCTCAGTGTTTGTT...

CDS

Download CDS FASTA

582 bp · TkA05G408310|TK1151|CDS

ATGAATTGGAACCCTAATTTAATCCTCTACACTTGCATCGCAAAAGACACAACAATTCTAGCTGAATTCAATTCAAAAGAATTCAATTCAAAAGATGAACATCTTAGCGATTTAGCTAAGAAGTGCCTGGAGAAGACGCCGCCCTTCCATTCCATCTTCTCTCACACCGTTCATGGCAAAACCTACATGTTTTTCATCCTTAATCGTTTTGTATATTTTGGAATCTTCGATGAATCGCTCGAGAAACCTCAGTGTTTGTT...

Protein

Download Protein FASTA

193 aa · TkA05G408310|TK1151|PROTEIN

MNWNPNLILYTCIAKDTTILAEFNSKEFNSKDEHLSDLAKKCLEKTPPFHSIFSHTVHGKTYMFFILNRFVYFGIFDESLEKPQCLLFLKSVKDAFTNMIDNRRTIKQRLYPPIPHCFQREFTPVFHHLLSSNPSSDSSSDSTHDHKEGSNSSLKMKKRFHEEDKLDSIVCVALFFICLWICKGFQSIVNYLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G408310`
TK1151 ID	TkA05G408310
OH-1004 ID	LXL04_021586
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.800
Protein coverage (%)	TK1151 69.948 / OH-1004 32.099 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G408310

Location Chr05:101523338-101523958 (-)

Description Similar to PHYL2.2: Phytolongin Phyl2.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52990`	Non-SNARE longin protein involved in membrane-trafficking machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021586 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0007033 vacuole organization Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0016020 membrane Cellular Component

GO:0031201 SNARE complex Cellular Component

GO:0031901 early endosome membrane Cellular Component

GO:0033263 CORVET complex Cellular Component

KEGG gene cross-reference

ath:AT1G33475

ath:AT3G54300

ath:AT4G10170

ath:AT4G27840

ath:AT5G52990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.370

Rank 1 · TkA05G408310 · TK1151

Lysosome / Vacuole0.200

Rank 2 · TkA05G408310 · TK1151

Nucleus0.194

Rank 3 · TkA05G408310 · TK1151

Golgi apparatus0.186

Rank 4 · TkA05G408310 · TK1151

Cytoplasm0.183

Rank 5 · TkA05G408310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13774Longin20-110 aa

PF27599CcsR_C111-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G408310	`PF13774`	Longin	20	110	3.3e-07	31.0
TkA05G408310	`PF27599`	CcsR_C	111	192	0.092	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVV3`	Arabidopsis thaliana	sp\|Q9LVV3\|PHL22_ARATH Phytolongin Phyl2.2	43.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card