TkA05G408270 | RubberDandelionOmics

Gene overview

TkA05G408270

Reference: TK1151 Chr: Chr05 Coordinates: 101513318-101516338 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1488 bp · TkA05G408270|TK1151|cDNA

GGAACATTAAAATTGAGTAATTGTCTAATTGACATATTAACCCAAAAAAACCAATAAACGTGCTTCCCTCAATGCTATCTCCCATCAGCCTCTAACCCTTTTCTTCTTCCTTTCATGTTCCCACTTTCTCTCTCCAAAACTCGCCATTTTCAAGCTTTTCTTGAAATCCACATACACCAGCTAAATTATTGTTGTCTTTTTTTCTACTAGATTAGTCAAACCTGTCATTTTTATACCCCACATTATTCTCTGCTAAATGT...

CDS

Download CDS FASTA

954 bp · TkA05G408270|TK1151|CDS

ATGGAGACATTACCTTCATATTCTTCATCTCCGGCCAACTACGACGAGATCGCTATGCAGCAAACAATGCTATTTTCCGATAGTCTGAAGGATTTAAAGAATTTGAGAAAACAACTATACGCAGCTGCCGAATACTTTGAATTATCGTACACCAATGATGACCAAAAACAATTAGTGGTGGAAACCTTAAAAGATTACGCTATCAAAGCTCTGGTCAACACAGTTGACCATTTGGGTGCGGTTTCTTGTAAAGTCAACGA...

Protein

Download Protein FASTA

317 aa · TkA05G408270|TK1151|PROTEIN

METLPSYSSSPANYDEIAMQQTMLFSDSLKDLKNLRKQLYAAAEYFELSYTNDDQKQLVVETLKDYAIKALVNTVDHLGAVSCKVNDLLTEKVNEVSTTELRVSSIQQRLSTCQGCFDHEGLAQQWSLIDIPKYHKRYILPVGETMQGGVRTKSKYQGCSLDDEDEWHEFKNAVRATIKEKETLPSSVSKRRSQSPSPQEPGSFAFTGAVTRKDLEKRSVSPRRFSLLRTGSLSSRPTTPNSRSTTPNRSRPTTPTSVSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G408270`
TK1151 ID	TkA05G408270
OH-1004 ID	LXL04_021585
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G408270

Location Chr05:101513318-101516338 (-)

Description Similar to ABIL2: Protein ABIL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49290`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release
`At5g24310`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release
`At5g42030`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0551800`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release
`Os01g0236400`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021585 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010090 trichome morphogenesis Biological Process

GO:0048364 root development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

KEGG gene cross-reference

ath:AT3G49290

ath:AT5G24310

ath:AT5G42030

dosa:Os01g0236400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.554

Rank 1 · TkA05G408270 · TK1151

Nucleus0.341

Rank 2 · TkA05G408270 · TK1151

Cell membrane0.220

Rank 3 · TkA05G408270 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA05G408270 · TK1151

Golgi apparatus0.043

Rank 5 · TkA05G408270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27594ABI20-90 aa

PF27569SCAR_helical47-112 aa

PF27569SCAR_helical161-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G408270	`PF27594`	ABI	20	90	7.4e-15	55.4
TkA05G408270	`PF27569`	SCAR_helical	47	112	0.027	14.9
TkA05G408270	`PF27569`	SCAR_helical	161	190	0.027	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3A3`	Arabidopsis thaliana	sp\|Q9M3A3\|ABIL2_ARATH Protein ABIL2	62.100%	Swiss-Prot	High
`Q6NMC6`	Arabidopsis thaliana	sp\|Q6NMC6\|ABIL3_ARATH Protein ABIL3	62.300%	Swiss-Prot	High
`Q9FHY1`	Arabidopsis thaliana	sp\|Q9FHY1\|ABIL4_ARATH Protein ABIL4	45.500%	Swiss-Prot	Medium
`Q5JKN2`	Oryza sativa subsp. japonica	sp\|Q5JKN2\|ABIL2_ORYSJ Putative protein ABIL2	42.800%	Swiss-Prot	Medium
`Q5NB83`	Oryza sativa subsp. japonica	sp\|Q5NB83\|ABIL3_ORYSJ Probable protein ABIL3	38.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card