TkA05G405210 | RubberDandelionOmics

Gene overview

TkA05G405210

Reference: TK1151 Chr: Chr05 Coordinates: 100795725-100797207 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1146 bp · TkA05G405210|TK1151|cDNA

ATTAAATTAGGCATAGAAGGCGAGGTGGAGGTAGTTCCTTCAGATACTTTGCCCATCAATCGTTAGCCACAAAGACTCCCAACATAGGCAGCCCAAATTACCCAACCGCCGATCGCCGTTCGCCGTCTTCCTCCAAACCCCCAATCCTTTGCTAAACCCTTAGGCATGACGACAAGCCTACCATGGCACCCTCTACTCTCCGCTAAATCCCAACGCTTTCATCCTTCCACCAACAAACGATTCACCAATTCTCCCCGACC...

CDS

Download CDS FASTA

762 bp · TkA05G405210|TK1151|CDS

ATGACGACAAGCCTACCATGGCACCCTCTACTCTCCGCTAAATCCCAACGCTTTCATCCTTCCACCAACAAACGATTCACCAATTCTCCCCGACCTAATTCAGTTACAGTAGCATTCAGGCGTAGCGATTTCGATGGCTTTGCTAAGAAAATAGCCTCAGGTGAAGCTTTGCGAGATGCTTGGCGTAGCGCTAATAACGGTTTTGAACAGCTCCTTTACGAGACGAAGAAAACCGCCGAGCGCATCGACCGGGAGTATTC...

Protein

Download Protein FASTA

253 aa · TkA05G405210|TK1151|PROTEIN

MTTSLPWHPLLSAKSQRFHPSTNKRFTNSPRPNSVTVAFRRSDFDGFAKKIASGEALRDAWRSANNGFEQLLYETKKTAERIDREYSVGRRLSSVAQSASDRARELDRDYLITQRWRTFTLDFSQNWQGYRKQISNFLDTPLGRSFGTIFFLWFALSGWLFRILIFATWVLPIAGPLLIGAVANNLVIKGSCPACKRQFMGYKNQMVRCGGCGNVVWQPKGIFFTQRGNSGSSSSSKSSKSGQEIIDVEFEEK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G405210`
TK1151 ID	TkA05G405210
OH-1004 ID	LXL04_021547
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G405210`
Location	Chr05:100795725-100797207 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021547` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.977

Rank 1 · TkA05G405210 · TK1151

Mitochondrion0.028

Rank 2 · TkA05G405210 · TK1151

Nucleus0.018

Rank 3 · TkA05G405210 · TK1151

Cytoplasm0.015

Rank 4 · TkA05G405210 · TK1151

Cell membrane0.008

Rank 5 · TkA05G405210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04956TrbC124-181 aa

PF13719Zn_ribbon_5191-215 aa

PF01667Ribosomal_S27e192-221 aa

PF14768RPA_interact_C192-216 aa

PF08271Zn_Ribbon_TF192-216 aa

PF23548Zn_ribbon_FGT1_2192-196 aa

PF00628PHD192-215 aa

PF13717Zn_ribbon_4192-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G405210	`PF04956`	TrbC	124	181	0.11	13.5
TkA05G405210	`PF13719`	Zn_ribbon_5	191	215	4.1	8.0
TkA05G405210	`PF01667`	Ribosomal_S27e	192	221	0.024	15.0
TkA05G405210	`PF14768`	RPA_interact_C	192	216	0.093	14.0
TkA05G405210	`PF08271`	Zn_Ribbon_TF	192	216	0.15	12.3
TkA05G405210	`PF23548`	Zn_ribbon_FGT1_2	192	196	0.41	11.0
TkA05G405210	`PF00628`	PHD	192	215	0.54	11.0
TkA05G405210	`PF13717`	Zn_ribbon_4	192	199	1.8	9.3
TkA05G405210	`PF13717`	Zn_ribbon_4	205	215	1.8	9.3
TkA05G405210	`PF23548`	Zn_ribbon_FGT1_2	207	221	0.41	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card