TkA05G403770 | RubberDandelionOmics

Gene overview

TkA05G403770

Reference: TK1151 Chr: Chr05 Coordinates: 100456433-100457910 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1345 bp · TkA05G403770|TK1151|cDNA

AATAGAAACAGAATCCTTCTGGAATTCGAATATTCGGTTATTTGAAAGCCCTATAAAACCCCCTTCTTTCCGTTTCCTCTGTAAAACAAACTCCAACTGATTAACATGTGCGAAAACTTAAACAAACAATACCAACTCTGCGAAGAACTCGGCCGGGGTCGGTTCGGCGTCGTCCGCCGGTGCTTCTCTTCCGACTCCGGTGACTCCTTCGCCTGTAAGTCCATCGACAAACGTCTCTTATCGGATCCCACGGACCTCGA...

CDS

Download CDS FASTA

846 bp · TkA05G403770|TK1151|CDS

ATGTGCGAAAACTTAAACAAACAATACCAACTCTGCGAAGAACTCGGCCGGGGTCGGTTCGGCGTCGTCCGCCGGTGCTTCTCTTCCGACTCCGGTGACTCCTTCGCCTGTAAGTCCATCGACAAACGTCTCTTATCGGATCCCACGGACCTCGAGTGCATCGATAAAGAACCGAAAATTCTTCACGTCCTTGGTGGAAACCCCCACATAGTCCAAATCCATGGTCTCTACGAAGACGATAATTACCTCCACATGATTAT...

Protein

Download Protein FASTA

281 aa · TkA05G403770|TK1151|PROTEIN

MCENLNKQYQLCEELGRGRFGVVRRCFSSDSGDSFACKSIDKRLLSDPTDLECIDKEPKILHVLGGNPHIVQIHGLYEDDNYLHMIMDLCDSPDLFDRISNQNGVFSESEAFSVFSPLISAISYCHRLGIAHRDIKPDNVLFDSRGKLKLADFGSAEWFGMNERTTMTGVVGTPYYVAPEVLSGREYNEKVDVWSAGVILYIMLAGVPPFYGETPTETFQAVLRSNLRFPTRIFRSVSPEAKDLLRKMLCKDVSRRFSAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G403770`
TK1151 ID	TkA05G403770
OH-1004 ID	LXL04_021539
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G403770

Location Chr05:100456433-100457910 (+)

Description Similar to PPCK1: Phosphoenolpyruvate carboxylase kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08650`	Calcium-independent kinase involved in light-dependent phosphoenolpyruvate carboxylase phosphorylation.	No verified direct reference in this release
`At3g04530`	Calcium-independent kinase involved in light-dependent phosphoenolpyruvate carboxylase phosphorylation.	No verified direct reference in this release
`At1g61950`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At5g12180`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At4g04720`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021539 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0046898 response to cycloheximide Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G08650

ath:AT1G61950

ath:AT3G04530

ath:AT5G12180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.594

Rank 1 · TkA05G403770 · TK1151

Cytoplasm0.594

Rank 2 · TkA05G403770 · TK1151

Cell membrane0.053

Rank 3 · TkA05G403770 · TK1151

Mitochondrion0.046

Rank 4 · TkA05G403770 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA05G403770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase9-268 aa

PF07714PK_Tyr_Ser-Thr10-263 aa

PF02007MtrH59-100 aa

PF17667Pkinase_fungal108-195 aa

PF14531Kinase-like119-255 aa

PF03109ABC1126-168 aa

PF01636APH127-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G403770	`PF00069`	Pkinase	9	268	9.9e-73	245.5
TkA05G403770	`PF07714`	PK_Tyr_Ser-Thr	10	263	2.3e-30	106.5
TkA05G403770	`PF02007`	MtrH	59	100	0.3	10.9
TkA05G403770	`PF17667`	Pkinase_fungal	108	195	0.018	14.5
TkA05G403770	`PF14531`	Kinase-like	119	255	7.2e-05	22.9
TkA05G403770	`PF03109`	ABC1	126	168	0.064	13.1
TkA05G403770	`PF01636`	APH	127	148	0.089	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SPK4`	Arabidopsis thaliana	sp\|Q9SPK4\|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1	57.500%	Swiss-Prot	High
`Q93VK0`	Arabidopsis thaliana	sp\|Q93VK0\|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2	54.700%	Swiss-Prot	High
`Q1PFH8`	Arabidopsis thaliana	sp\|Q1PFH8\|CDPKJ_ARATH Calcium-dependent protein kinase 19	43.600%	Swiss-Prot	Medium
`Q9FMP5`	Arabidopsis thaliana	sp\|Q9FMP5\|CDPKH_ARATH Calcium-dependent protein kinase 17	42.700%	Swiss-Prot	Medium
`Q9ZSA2`	Arabidopsis thaliana	sp\|Q9ZSA2\|CDPKL_ARATH Calcium-dependent protein kinase 21	44.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card