TkA05G401630 | RubberDandelionOmics

Gene overview

TkA05G401630

Reference: TK1151 Chr: Chr05 Coordinates: 99942423-99944437 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1278 bp · TkA05G401630|TK1151|cDNA

GACAGCTTCTATATATATTTCACCAATTGTTAACGTAACGCCACCCGATACAAAACCTTCAATCGCCTCTCTCTTGAAAATGGGTACCGGATTCCTGTTTTTGGGGTTGTTTTTGGCGACGGCGGTCGGCGGTGGTGCTGCTAAAGTAAACGAACCGCGGCCGTTGTTCGTTTTCGGCGACTCTCTGGTGGACAACGGCAACAACAATTTCTTGTATACGTCTGCACGTGCCGACACACCACCTTATGGCATCGACACTC...

CDS

Download CDS FASTA

1095 bp · TkA05G401630|TK1151|CDS

ATGGGTACCGGATTCCTGTTTTTGGGGTTGTTTTTGGCGACGGCGGTCGGCGGTGGTGCTGCTAAAGTAAACGAACCGCGGCCGTTGTTCGTTTTCGGCGACTCTCTGGTGGACAACGGCAACAACAATTTCTTGTATACGTCTGCACGTGCCGACACACCACCTTATGGCATCGACACTCCGTCGCAGCGTCCCACCGGCCGATTCTCCAACGGCCTCAACATCCCCGACGTTCTCAGTGAGCTAATCGGATCGGAGCC...

Protein

Download Protein FASTA

364 aa · TkA05G401630|TK1151|PROTEIN

MGTGFLFLGLFLATAVGGGAAKVNEPRPLFVFGDSLVDNGNNNFLYTSARADTPPYGIDTPSQRPTGRFSNGLNIPDVLSELIGSEPVVPYLSPELTDKRLPLGANFASAGIGILNDTGFQFGDVLRVPLQLEYFREYKRRLASLVGEKQAKNIVNKALVLVSLGGNDFVNNYFLYPFSPRSLQFPLPDYVSFLMSEYRKILKTLYGLGVRRAILMGSGPLGCAPAEIAQHSVDGECAGNLQAAAELFEPQLAEMVKSIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G401630`
TK1151 ID	TkA05G401630
OH-1004 ID	LXL04_021525
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G401630

Location Chr05:99942423-99944437 (+)

Description Similar to LTL1: GDSL esterase/lipase LTL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04290`	Involved in the mechanisms of salt tolerance.	Overexpression of Arabidopsis thaliana LTL1, a salt-induced gene encoding a GDSL-motif lipase, increases salt tolerance in yeast and transgenic plants.2006 · DOI: 10.1111/j.1365-3040.2006.01565.x
`At5g33370`	GDSL esterase/lipase At5g33370.	No verified direct reference in this release
`At5g18430`	GDSL esterase/lipase At5g18430.	No verified direct reference in this release
`At4g28780`	GDSL esterase/lipase At4g28780.	No verified direct reference in this release
`At2g04570`	GDSL esterase/lipase At2g04570.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021525 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009751 response to salicylic acid Biological Process

GO:0010226 response to lithium ion Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0160062 cutin-based cuticle development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT2G23540

ath:AT3G04290

ath:AT4G28780

ath:AT5G18430

ath:AT5G33370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.591

Rank 1 · TkA05G401630 · TK1151

Lysosome / Vacuole0.096

Rank 2 · TkA05G401630 · TK1151

Endoplasmic reticulum0.087

Rank 3 · TkA05G401630 · TK1151

Cell membrane0.078

Rank 4 · TkA05G401630 · TK1151

Cytoplasm0.075

Rank 5 · TkA05G401630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL29-341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G401630	`PF00657`	Lipase_GDSL	29	341	4.6e-32	112.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8Y5`	Arabidopsis thaliana	sp\|Q9M8Y5\|LTL1_ARATH GDSL esterase/lipase LTL1	59.700%	Swiss-Prot	High
`Q8LB81`	Arabidopsis thaliana	sp\|Q8LB81\|GDL79_ARATH GDSL esterase/lipase At5g33370	62.500%	Swiss-Prot	High
`Q5PNZ0`	Arabidopsis thaliana	sp\|Q5PNZ0\|GDL77_ARATH GDSL esterase/lipase At5g18430	58.100%	Swiss-Prot	High
`Q9SVU5`	Arabidopsis thaliana	sp\|Q9SVU5\|GDL67_ARATH GDSL esterase/lipase At4g28780	57.900%	Swiss-Prot	High
`Q9SJB4`	Arabidopsis thaliana	sp\|Q9SJB4\|GDL34_ARATH GDSL esterase/lipase At2g04570	39.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card