TkA05G400890 | RubberDandelionOmics

Gene overview

TkA05G400890

Reference: TK1151 Chr: Chr05 Coordinates: 99732704-99733462 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

759 bp · TkA05G400890|TK1151|cDNA

ATGACCCGATTGACCTACACCCTAGATGAAATCGAGGGACCTCTGGAAGTATCCTCCGATGGCAGCATCAAATTCGAGGAAAAAGACGGAATTGACTACGCTGCAGTCACTGTTCAGCTTCCCGGAGGTGAACGTGTGCCCTTTCTTTTCACCATCAAACAACTTGTAGCATCTGGTAAACCGGAGAGCTTCGGTGGGGAATTTCTAGTACCATCGTACAGAGGTTCTTCGTTTCTAGACCCAAAGGGCAGAGGTGGATC...

CDS

Download CDS FASTA

759 bp · TkA05G400890|TK1151|CDS

ATGACCCGATTGACCTACACCCTAGATGAAATCGAGGGACCTCTGGAAGTATCCTCCGATGGCAGCATCAAATTCGAGGAAAAAGACGGAATTGACTACGCTGCAGTCACTGTTCAGCTTCCCGGAGGTGAACGTGTGCCCTTTCTTTTCACCATCAAACAACTTGTAGCATCTGGTAAACCGGAGAGCTTCGGTGGGGAATTTCTAGTACCATCGTACAGAGGTTCTTCGTTTCTAGACCCAAAGGGCAGAGGTGGATC...

Protein

Download Protein FASTA

252 aa · TkA05G400890|TK1151|PROTEIN

MTRLTYTLDEIEGPLEVSSDGSIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALRAGGRGDKEELSKENVKNVAASTGKITLSVTSSKEILRETVRILRYNLSGFMAIGAVLICPVCCSSIECSSRSVDPSIVKRLAIGAVLIWKTNRLHLPSSMHGNRRLLNFISRSTYRRQQPPLRNRISPQFNRLYCNHHRLIFLSVLRKRHHHLRA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G400890`
TK1151 ID	TkA05G400890
OH-1004 ID	LXL04_021502
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.300
Protein coverage (%)	TK1151 74.206 / OH-1004 68.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G400890

Location Chr05:99732704-99733462 (+)

Description Similar to PSBO: Oxygen-evolving enhancer protein 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50820`	Stabilizes the manganese cluster which is the primary site of water splitting.	The manganese-stabilizing protein is required for photosystem II assembly/stability and photoautotrophy in higher plants.2005 · DOI: 10.1074/jbc.m501550200 The Arabidopsis PsbO2 protein regulates dephosphorylation and turnover of the photosystem II reaction centre D1 protein.2007 · DOI: 10.1111/j.1365-313x.2006.02976.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021502 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010207 photosystem II assembly Biological Process

GO:0019684 photosynthesis, light reaction Biological Process

GO:0042549 photosystem II stabilization Biological Process

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009654 photosystem II oxygen evolving complex Cellular Component

GO:0030095 chloroplast photosystem II Cellular Component

GO:0010242 oxygen evolving activity Molecular Function

KEGG gene cross-reference

nta:107820252

sly:544299

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.305

Rank 1 · TkA05G400890 · TK1151

Nucleus0.276

Rank 2 · TkA05G400890 · TK1151

Mitochondrion0.151

Rank 3 · TkA05G400890 · TK1151

Plastid0.148

Rank 4 · TkA05G400890 · TK1151

Cell membrane0.131

Rank 5 · TkA05G400890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01716MSP1-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G400890	`PF01716`	MSP	1	131	1.6e-53	182.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S841`	Arabidopsis thaliana	sp\|Q9S841\|PSBO2_ARATH Oxygen-evolving enhancer protein 1-2, chloroplastic	76.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card