TkA05G400630 | RubberDandelionOmics

Gene overview

TkA05G400630

Reference: TK1151 Chr: Chr05 Coordinates: 99655791-99663244 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2709 bp · TkA05G400630|TK1151|cDNA

AAAATATTGGGTACATGCTGTCAAATAACAATGAGTGAGTGAGTATCTATCTTGGAGCATTTTCTGCATGAGAAATCATTATCAACTCATTGCAGTTGCAGGGATCTCTCTCTCTCTCTCTACACATGAAAAACTTACAACCCAAATGTCTCTCAACTTTTTGAGCCATATTTTTATTTTCAATATATAATCTCCAACACGCCACCATCGATCCTTCATGCTCTGCTATTCAACCACTCGATGATCTCCCTTTTGATCTC...

CDS

Download CDS FASTA

1155 bp · TkA05G400630|TK1151|CDS

ATGTCTCTCAACATGATTTCAAATGGAAATTACTCCATTTATGGGGGTCAGTGGATGAACTACAAGTCCTGTAAGACTAAGCCATTGAAGTTGATGTCTGAATGTCCGAATTTAATCTCAATTTCTAGGGTTAGGAGTTCTTTGCAGTCTCATCAGGCATCAGGATCTTTCTCTTTGCAAGGTGCTCCATTTGCTCATCTTTTAGCTACATCATCTCATAGGAATCTCACCCCTATCACACCAACCAACTTATCTCCAAA...

Protein

Download Protein FASTA

384 aa · TkA05G400630|TK1151|PROTEIN

MSLNMISNGNYSIYGGQWMNYKSCKTKPLKLMSECPNLISISRVRSSLQSHQASGSFSLQGAPFAHLLATSSHRNLTPITPTNLSPKHHSTISPKASKDATQPTLENSSNLVATQQYRHLWDQCENCYGLNYKQFLKKKLHVCEHCGHHLKMSSSDRIELLIDPGTWNPLDETMVSVDPIEFDSEDEPYKSRIDSYQRKTGLTEGVQTGTGKLNGIAVAIGVMDFQFMGGSMGSVVGEKLTRLIEHAAKEFLPLIIVCAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G400630`
TK1151 ID	TkA05G400630
OH-1004 ID	LXL04_021497
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.000
Protein coverage (%)	TK1151 25.260 / OH-1004 36.742 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G400630`
Location	Chr05:99655791-99663244 (+)
Description	Similar to TIC20-I: Protein TIC 20-I, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021497` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0015031 protein transport Biological Process GO:0045037 protein import into chloroplast stroma Biological Process GO:0005739 mitochondrion Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009706 chloroplast inner membrane Cellular Component GO:0008320 protein transmembrane transporter activity Molecular Function
KEGG gene cross-reference	ath:AT1G04940 ath:AT4G03320 syn:sll1737 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.783

Rank 1 · TkA05G400630 · TK1151

Plastid0.201

Rank 2 · TkA05G400630 · TK1151

Cytoplasm0.047

Rank 3 · TkA05G400630 · TK1151

Nucleus0.031

Rank 4 · TkA05G400630 · TK1151

Cell membrane0.014

Rank 5 · TkA05G400630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10080FtrD-like115-154 aa

PF17848Zn_ribbon_ACC121-146 aa

PF24046At4g08330138-183 aa

PF00355Rieske142-152 aa

PF01039Carboxyl_trans175-346 aa

PF00355Rieske236-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G400630	`PF10080`	FtrD-like	115	154	0.11	13.3
TkA05G400630	`PF17848`	Zn_ribbon_ACC	121	146	1.2	10.2
TkA05G400630	`PF24046`	At4g08330	138	183	0.098	13.4
TkA05G400630	`PF00355`	Rieske	142	152	0.18	12.4
TkA05G400630	`PF01039`	Carboxyl_trans	175	346	8.4e-23	81.5
TkA05G400630	`PF00355`	Rieske	236	289	0.18	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card