TkA05G398730 | RubberDandelionOmics

Gene overview

TkA05G398730

Reference: TK1151 Chr: Chr05 Coordinates: 99133436-99136471 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2548 bp · TkA05G398730|TK1151|cDNA

AGTAAACAAATTTTGAAGGAAAAACGGCAACAGATGTGAATCTGACGTTTGGATGCGTATCCAACCTGTAACATCCACTTTTGGCTGCCGACCACCTCTCCGAATCCGCCCCCACCATCTCGCTCTATCAGTCGATATCTGTCGACTAGATTACATCTCACCCTCATCAATCAACCTCACTAAGCTTTTCAGCAACAATGACGGATGATGATTACGCAATTAATGAGCAGACTTCCAAGCAACACTGGGAAGATCTCCTC...

CDS

Download CDS FASTA

1158 bp · TkA05G398730|TK1151|CDS

ATGACGGATGATGATTACGCAATTAATGAGCAGACTTCCAAGCAACACTGGGAAGATCTCCTCCGTAAGATGTTGCCGGTCGGCGCCCCCTTACCCGACGAAGATCAACTCGATTTCTCAATTTCCGTCGAATACCAACCCCCCACGCACCCACACAATAACGTCCACTACCACCCCCTTTCCGGAACCACCAGCCCTATACCCATAATCAAAAATTCAAATTTCACCAGACCCCCAAAAATTCACCATAAGTACACTAC...

Protein

Download Protein FASTA

385 aa · TkA05G398730|TK1151|PROTEIN

MTDDDYAINEQTSKQHWEDLLRKMLPVGAPLPDEDQLDFSISVEYQPPTHPHNNVHYHPLSGTTSPIPIIKNSNFTRPPKIHHKYTTATSNLAASVVTPVPESGEDKNSDVPSFDTTQDEEEEQQEEDNASSTSVTASPVVETGGKKNQKKSICSRCGNGNRLKDKEGCIVCDARYCNNCLLKAMGSMPEGRKCVGCIGQPIDESRRQKLGKSSKMLSKICSPLEVRQIMLAEKECFANQLRPEQLVVNGRQLKQEDLSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G398730`
TK1151 ID	TkA05G398730
OH-1004 ID	LXL04_021473
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 48.412 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G398730

Location Chr05:99133436-99136471 (+)

Description Similar to XLG3: Extra-large guanine nucleotide-binding protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31930`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x Regulation of root-wave response by extra large and conventional G proteins in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03506.x
`At2g23460`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x
`At4g34390`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x Arabidopsis extra large G-protein 2 (XLG2) interacts with the Gbeta subunit of heterotrimeric G protein and functions in disease resistance.2009 · DOI: 10.1093/mp/ssp001 Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.317412

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021473 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0034052 positive regulation of plant-type hypersensitive response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048639 positive regulation of developmental growth Biological Process

GO:0050832 defense response to fungus Biological Process

GO:2000280 regulation of root development Biological Process

KEGG gene cross-reference

ath:AT1G31930

ath:AT2G23460

ath:AT4G34390

dosa:Os05g0333200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.370

Rank 1 · TkA05G398730 · TK1151

Cytoplasm0.368

Rank 2 · TkA05G398730 · TK1151

Nucleus0.332

Rank 3 · TkA05G398730 · TK1151

Endoplasmic reticulum0.081

Rank 4 · TkA05G398730 · TK1151

Golgi apparatus0.068

Rank 5 · TkA05G398730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27511ComFA_N135-186 aa

PF22586ANCHR-like_BBOX169-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G398730	`PF27511`	ComFA_N	135	186	0.0044	18.1
TkA05G398730	`PF22586`	ANCHR-like_BBOX	169	183	5.2	8.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C516`	Arabidopsis thaliana	sp\|Q9C516\|XLG3_ARATH Extra-large guanine nucleotide-binding protein 3	47.400%	Swiss-Prot	Medium
`O80462`	Arabidopsis thaliana	sp\|O80462\|XLG1_ARATH Extra-large guanine nucleotide-binding protein 1	62.400%	Swiss-Prot	Medium
`C6KIE6`	Arabidopsis thaliana	sp\|C6KIE6\|XLG2_ARATH Extra-large guanine nucleotide-binding protein 2	53.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card