Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2654 bp · TkA05G394810|TK1151|cDNA
CTACTCGCAAAGAATTTACCCTGATATTTTCTTTCGCCCAAAGGGTTTATATACTCTCTCTCTCCCCTGCAAACTAGAAATCCTGCAGATTCTCTCTTCCCAAGAAAATCTCGAAAAATCAAACCTCTTTATGCTTCGAAACGAAGAAACTTGAAACTCCCAGAAAAAAAAAATCAATCTGCACACACATACAGCTATGTATCAACACCTCATTTCTGACCACCAACCTTGTGCGCTCTTTTGTTACTCAAGACTCTCGC...
1968 bp · TkA05G394810|TK1151|CDS
ATGGCTCAAGATAACTCAATCGGCGAATCAACTTCAAGAAAACAAGGTCTATTGAAAGATCAAGTTCGATTACTCAAGAGAAAAGACTGCGATCGATCTGAAATCGTTCAAATTAAAGATACTTTATCGTTTGAAAAGGGATTCTTTGTTGTAATTCGAGCATGCCAGTTATTAGTCCAAACAAACGAAGGAATTGTCCTGGTCGGGTTGGCCGGTCCTTCTGGTGCTGGAAAAACCGCATTCACCGAGAAAATCCTTAA...
Protein
Download Protein FASTA655 aa · TkA05G394810|TK1151|PROTEIN
MAQDNSIGESTSRKQGLLKDQVRLLKRKDCDRSEIVQIKDTLSFEKGFFVVIRACQLLVQTNEGIVLVGLAGPSGAGKTAFTEKILNFMPSVAVISMDNYNDATRVIDGNFDDPRLTDYDTLLKNIHDLKEGKTIEVPIYDFKSSCRTGYRALEVPSSRIVIVEGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIYQISETVYPMYKAFIEPDLQTAQIKIVNKFNPFTGFQNPTYILKSSRDVS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G394810 |
|---|---|
| TK1151 ID | TkA05G394810 |
| OH-1004 ID | LXL04_031495 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 65.500 |
| Protein coverage (%) | TK1151 98.321 / OH-1004 98.315Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G394810 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:98129120-98133487 (-) | |||||||||
| Description | Similar to TTM1: Inorganic pyrophosphatase TTM1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0002239 response to oomycetes Biological Process GO:0006952 defense response Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009751 response to salicylic acid Biological Process GO:0010113 negative regulation of systemic acquired resistance Biological Process GO:0044206 UMP salvage Biological Process GO:0044211 CTP salvage Biological Process GO:0098542 defense response to other organism Biological Process GO:1900055 regulation of leaf senescence Biological Process GO:1900425 negative regulation of defense response to bacterium Biological Process GO:1902289 negative regulation of defense response to oomycetes Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G26190 ath:AT1G73980 ddi:DDB_G0271146 ddi:DDB_G0283371 ddr:Deide_00390 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF20720nSTAND353-110 aaPF02367TsaE59-89 aaPF00485PRK68-236 aaPF13671AAA_3368-108 aaPF13479AAA_2469-129 aaPF28335LRRC43_C172-199 aaPF01928CYTH267-404 aaPF13671AAA_33290-305 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G394810 | PF20720 | nSTAND3 | 53 | 110 | 0.029 | 14.8 |
| TkA05G394810 | PF02367 | TsaE | 59 | 89 | 0.26 | 11.9 |
| TkA05G394810 | PF00485 | PRK | 68 | 236 | 5.3e-25 | 89.1 |
| TkA05G394810 | PF13671 | AAA_33 | 68 | 108 | 0.26 | 12.3 |
| TkA05G394810 | PF13479 | AAA_24 | 69 | 129 | 0.22 | 11.9 |
| TkA05G394810 | PF28335 | LRRC43_C | 172 | 199 | 0.2 | 11.5 |
| TkA05G394810 | PF01928 | CYTH | 267 | 404 | 2e-17 | 64.3 |
| TkA05G394810 | PF13671 | AAA_33 | 290 | 305 | 0.26 | 12.3 |
| TkA05G394810 | PF10267 | Tmemb_cc2 | 440 | 535 | 2.4 | 8.0 |
| TkA05G394810 | PF20720 | nSTAND3 | 443 | 461 | 0.029 | 14.8 |
| TkA05G394810 | PF08614 | ATG16 | 480 | 526 | 7.2 | 7.5 |
| TkA05G394810 | PF08614 | ATG16 | 480 | 621 | 7.2 | 7.5 |
| TkA05G394810 | PF14362 | DUF4407 | 486 | 625 | 0.53 | 10.2 |
| TkA05G394810 | PF14282 | FlxA | 490 | 523 | 4.7 | 8.2 |
| TkA05G394810 | PF04728 | LPP | 498 | 524 | 0.21 | 12.6 |
| TkA05G394810 | PF08653 | DASH_Dam1 | 501 | 523 | 0.28 | 11.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.