TkA05G392160 | RubberDandelionOmics

Gene overview

TkA05G392160

Reference: TK1151 Chr: Chr05 Coordinates: 97462140-97466280 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2734 bp · TkA05G392160|TK1151|cDNA

CTAAAACCCCAGCCCTATAAGATTTTTCCATCTTCCTTGTTTAGAGATGAGCTAAATTTTGCTCTCATGGAATCCTTAAGCTTAAGGGTGCCACCACGTCCACCCCTCCCTTCTCAACATCCAGACGTCGAGCCCATCAAGCACAATCTTCTAAAAAATGGCGTCATTCCAACCCCTAAAATCATCCACACCCTCCGCAAAAAAAGCTTCAAAAAATCAACCCGCCGCCGTCCTCCGCCCAACCAAACCCCAGAAGAAGA...

CDS

Download CDS FASTA

1029 bp · TkA05G392160|TK1151|CDS

ATGGAATCCTTAAGCTTAAGGGTGCCACCACGTCCACCCCTCCCTTCTCAACATCCAGACGTCGAGCCCATCAAGCACAATCTTCTAAAAAATGGCGTCATTCCAACCCCTAAAATCATCCACACCCTCCGCAAAAAAAGCTTCAAAAAATCAACCCGCCGCCGTCCTCCGCCCAACCAAACCCCAGAAGAAGAACAAATTCAAGATGAAGAAGCCAATTTCCAGACGTTAAAGGCCGAATTCAAAACCTTCAACAGGGC...

Protein

Download Protein FASTA

342 aa · TkA05G392160|TK1151|PROTEIN

MESLSLRVPPRPPLPSQHPDVEPIKHNLLKNGVIPTPKIIHTLRKKSFKKSTRRRPPPNQTPEEEQIQDEEANFQTLKAEFKTFNRAIVKATKSKQDMDINHGVVSSSSLVGKPWERLERTELREHASTNKEFVGGDNLKYEHLDELSEYIEKERDKFKWILDDDIEFEDGMLQNNWVPPKRKVSDGEAIRFLVDRLSGTEPSMKNWKFSKMMKQSELQFTEDQLLKIVGGLGDKGQWRHALSVVKWIYNSKEHKHFKSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G392160`
TK1151 ID	TkA05G392160
OH-1004 ID	LXL04_006690
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.800
Protein coverage (%)	TK1151 98.246 / OH-1004 33.871 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G392160

Location Chr05:97462140-97466280 (+)

Description Similar to DG1: Pentatricopeptide repeat-containing protein At5g67570, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67570`	Involved in the regulation of early chloroplast development and chloroplast gene expression in a SIGF-dependent manner.	No verified direct reference in this release
`At1g30610`	May play a role in embryogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006690 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010239 chloroplast mRNA processing Biological Process

GO:0042793 plastid transcription Biological Process

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G30610

ath:AT5G02860

ath:AT5G67570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.715

Rank 1 · TkA05G392160 · TK1151

Mitochondrion0.139

Rank 2 · TkA05G392160 · TK1151

Nucleus0.103

Rank 3 · TkA05G392160 · TK1151

Cytoplasm0.026

Rank 4 · TkA05G392160 · TK1151

Cell membrane0.016

Rank 5 · TkA05G392160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27871CLB_0814_fam140-156 aa

PF12921ATP13207-255 aa

PF23276TPR_24211-250 aa

PF01535PPR229-245 aa

PF13041PPR_2229-247 aa

PF27871CLB_0814_fam245-274 aa

PF23276TPR_24259-327 aa

PF13041PPR_2261-299 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G392160	`PF27871`	CLB_0814_fam	140	156	0.73	10.6
TkA05G392160	`PF12921`	ATP13	207	255	0.15	12.7
TkA05G392160	`PF23276`	TPR_24	211	250	0.025	15.2
TkA05G392160	`PF01535`	PPR	229	245	9.5e-07	29.4
TkA05G392160	`PF13041`	PPR_2	229	247	0.00015	22.5
TkA05G392160	`PF27871`	CLB_0814_fam	245	274	0.73	10.6
TkA05G392160	`PF23276`	TPR_24	259	327	0.025	15.2
TkA05G392160	`PF13041`	PPR_2	261	299	0.00015	22.5
TkA05G392160	`PF01535`	PPR	262	287	9.5e-07	29.4
TkA05G392160	`PF13812`	PPR_3	263	302	0.072	13.9
TkA05G392160	`PF12921`	ATP13	289	323	0.15	12.7
TkA05G392160	`PF13041`	PPR_2	294	324	0.00015	22.5
TkA05G392160	`PF13812`	PPR_3	294	325	0.072	13.9
TkA05G392160	`PF01535`	PPR	299	324	9.5e-07	29.4
TkA05G392160	`PF27871`	CLB_0814_fam	314	334	0.73	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJW6`	Arabidopsis thaliana	sp\|Q9FJW6\|PP451_ARATH Pentatricopeptide repeat-containing protein At5g67570, chloroplastic	48.000%	Swiss-Prot	Medium
`Q9SA76`	Arabidopsis thaliana	sp\|Q9SA76\|PPR64_ARATH Pentatricopeptide repeat-containing protein At1g30610, chloroplastic	40.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card