TkA05G377090 | RubberDandelionOmics

Gene overview

TkA05G377090

Reference: TK1151 Chr: Chr05 Coordinates: 93621813-93623420 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1053 bp · TkA05G377090|TK1151|cDNA

TGTCAAAAGAAAATCAAAAAGAAAGAGGGGTTGACTCGATTGCCAAAGGTGCGGACTGAGCATACAAATTCAGGGGGAAGGAAAAAACATGTCAAGTTTGATGAATTAGGTAGGTTTACAGGGAAGTACAGAGCACAAATATCAAGTTTTTTGGGAGACTTGGTAAGGGAGAAGGTGGGACTAAGTGTTCTTAATTGGAGGAATGTTACAAAAGAAGTGAGGGATAAGTTATGGGAGGAAATAACGCGTTATTATGAAAT...

CDS

Download CDS FASTA

1053 bp · TkA05G377090|TK1151|CDS

TGTCAAAAGAAAATCAAAAAGAAAGAGGGGTTGACTCGATTGCCAAAGGTGCGGACTGAGCATACAAATTCAGGGGGAAGGAAAAAACATGTCAAGTTTGATGAATTAGGTAGGTTTACAGGGAAGTACAGAGCACAAATATCAAGTTTTTTGGGAGACTTGGTAAGGGAGAAGGTGGGACTAAGTGTTCTTAATTGGAGGAATGTTACAAAAGAAGTGAGGGATAAGTTATGGGAGGAAATAACGCGTTATTATGAAAT...

Protein

Download Protein FASTA

350 aa · TkA05G377090|TK1151|PROTEIN

CQKKIKKKEGLTRLPKVRTEHTNSGGRKKHVKFDELGRFTGKYRAQISSFLGDLVREKVGLSVLNWRNVTKEVRDKLWEEITRYYEIEDTRRKYVMTRLGALLRNFRRKLYAKYIEPNLKNPSKLAVIPKRYRTIILNQEHWNAFVTYTQSQNFKDVSKKTIIARSKSIYDHRMGRGGYTALREKLVQKQVIDKHEMPPRSFMWYKGRENKAGEIVDDGVQVIAEKLQEQEQKIKDGELSLDPGEDAMTVVFGKENGSYL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G377090`
TK1151 ID	TkA05G377090
OH-1004 ID	LXL04_029747
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.400
Protein coverage (%)	TK1151 99.143 / OH-1004 59.520 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G377090`
Location	Chr05:93621813-93623420 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029747` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.954

Rank 1 · TkA05G377090 · TK1151

Cytoplasm0.109

Rank 2 · TkA05G377090 · TK1151

Mitochondrion0.019

Rank 3 · TkA05G377090 · TK1151

Cell membrane0.014

Rank 4 · TkA05G377090 · TK1151

Extracellular0.011

Rank 5 · TkA05G377090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21552WHD_TFC351-86 aa

PF28608DUF844379-89 aa

PF28608DUF8443137-168 aa

PF03004Transposase_24138-268 aa

PF21552WHD_TFC3142-184 aa

PF21552WHD_TFC3218-242 aa

PF03004Transposase_24274-316 aa

PF28608DUF8443282-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G377090	`PF21552`	WHD_TFC3	51	86	0.016	16.0
TkA05G377090	`PF28608`	DUF8443	79	89	0.0037	18.6
TkA05G377090	`PF28608`	DUF8443	137	168	0.0037	18.6
TkA05G377090	`PF03004`	Transposase_24	138	268	8.2e-10	39.7
TkA05G377090	`PF21552`	WHD_TFC3	142	184	0.016	16.0
TkA05G377090	`PF21552`	WHD_TFC3	218	242	0.016	16.0
TkA05G377090	`PF03004`	Transposase_24	274	316	8.2e-10	39.7
TkA05G377090	`PF28608`	DUF8443	282	336	0.0037	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card