TkA05G371780 | RubberDandelionOmics

Gene overview

TkA05G371780

Reference: TK1151 Chr: Chr05 Coordinates: 92347259-92349836 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1734 bp · TkA05G371780|TK1151|cDNA

TTTTAACCTACAGATGTGGGTATGCAAAAGGACACCTGTCCGTTTTGTGGAATAGGTTGTCCAGATGAGTACGCAATCATCGTTTTCCACCGCCTTCTCAGTCTTCCTCTTTCTCTCTTGCTGTTCCGATCGGTTCTCTTCCTCCGGATTTGGTGAGATTGGAGATGGTGGTTTTGCTCCGGAGGAAAGGGACGATGAGCTTTTCGTAAATGGGAACGAGGATTAGGGCGTTAATGGCGGAAAAGACTGGAACAGAGCCT...

CDS

Download CDS FASTA

396 bp · TkA05G371780|TK1151|CDS

ATGACGGCGCCTTGGCTGAGGAAGAAGGTGGAAAGCTGCGCGAAGGAGATGGAGATCGCGATGGTGGTTGCCCAGATAGGTTCACCGCGTCGGTTTAATTTCGAATTGCTGTGGATTTCCCTTTGTCAGCGTCGAGCGGCGGTGAAGAATATAGGATCCGTTTCAACGGCGGCAGATTTCTCATACCTCGATACTTTGTTCGATTTAACGGTGGAGGGGCGGAAACATCCTCTCACGAATCCACAGATCTTCACTTTGTG...

Protein

Download Protein FASTA

131 aa · TkA05G371780|TK1151|PROTEIN

MTAPWLRKKVESCAKEMEIAMVVAQIGSPRRFNFELLWISLCQRRAAVKNIGSVSTAADFSYLDTLFDLTVEGRKHPLTNPQIFTLCSKFLNGGTEFTGTAIEWAIASLYETEVFFYGFIEWNKGYGGLNS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G371780`
TK1151 ID	TkA05G371780
OH-1004 ID	LXL04_015727
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.600
Protein coverage (%)	TK1151 96.947 / OH-1004 61.353 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G371780

Location Chr05:92347259-92349836 (+)

Description Similar to CYP77A1: Cytochrome P450 77A1 (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04660`	Catalyzes the epoxidation of physiological unsaturated fatty acids in vitro.	Arabidopsis thaliana CYP77A4 is the first cytochrome P450 able to catalyze the epoxidation of free fatty acids in plants.2009 · DOI: 10.1111/j.1742-4658.2008.06819.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015727 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019395 fatty acid oxidation Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT5G04660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.321

Rank 1 · TkA05G371780 · TK1151

Cytoplasm0.183

Rank 2 · TkA05G371780 · TK1151

Extracellular0.138

Rank 3 · TkA05G371780 · TK1151

Mitochondrion0.109

Rank 4 · TkA05G371780 · TK1151

Nucleus0.065

Rank 5 · TkA05G371780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45061-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G371780	`PF00067`	p450	61	111	0.019	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ31`	Arabidopsis thaliana	sp\|Q9LZ31\|C77A4_ARATH Cytochrome P450 77A4	64.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card