TkA05G362010 | RubberDandelionOmics

Gene overview

TkA05G362010

Reference: TK1151 Chr: Chr05 Coordinates: 89878226-89880733 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1183 bp · TkA05G362010|TK1151|cDNA

CTACGGGTCACTCATATATATCATTCATATTTCATATGCACAAGAACTTATTACATATTCTACGTATCCTCTAAAAATGCATCAACCACCACTCTTTCTCTTATTCTCCTCATTTTCTCTCATGTTCATCTTATCAGTATCCACCACGAATACTCTCCTCTATAGCGGATGCTCACAACTCCGAGTCAGCCCAGGTACACCGTACGAGTCAAATGTCAACTCACTATTCACATCCCTAGTCAACTCAGCTTCCGTCTCCA...

CDS

Download CDS FASTA

810 bp · TkA05G362010|TK1151|CDS

ATGCATCAACCACCACTCTTTCTCTTATTCTCCTCATTTTCTCTCATGTTCATCTTATCAGTATCCACCACGAATACTCTCCTCTATAGCGGATGCTCACAACTCCGAGTCAGCCCAGGTACACCGTACGAGTCAAATGTCAACTCACTATTCACATCCCTAGTCAACTCAGCTTCCGTCTCCAACTTCAAAATCTCCATTTCCGGATCCACACAAACCAACCTCGTCTACGGTCTCTTCCAATGCCAAGGTGACCTCAC...

Protein

Download Protein FASTA

269 aa · TkA05G362010|TK1151|PROTEIN

MHQPPLFLLFSSFSLMFILSVSTTNTLLYSGCSQLRVSPGTPYESNVNSLFTSLVNSASVSNFKISISGSTQTNLVYGLFQCQGDLTSSNCKDCVTSSLSQLKTICPHAIGGIIQIEGCFVKYDYTSFFGVEDKTEVSKRCGPSIGYNSYVLNRRDAALAYLTAANGQYFRGGGSGVAQCVQDISASECQDCLVEASGRLRSECETSIWGDMFLGKCYIRYVDRQHHSKTNDEDVDKTLALTIGVIAGVVLLIVFLSSLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G362010`
TK1151 ID	TkA05G362010
OH-1004 ID	LXL04_021182
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.900
Protein coverage (%)	TK1151 81.413 / OH-1004 71.429 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G362010

Location Chr05:89878226-89880733 (+)

Description Similar to PDLP6: Plasmodesmata-located protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01660`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At5g37660`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At1g70690`	Modulates cell-to-cell trafficking.	A plasmodesmata-localized protein mediates crosstalk between cell-to-cell communication and innate immunity in Arabidopsis.2011 · DOI: 10.1105/tpc.111.087742
`At3g60720`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At5g48540`	Cysteine-rich repeat secretory protein 55.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021182 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009615 response to virus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051707 response to other organism Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0001872 (1->3)-beta-D-glucan binding Molecular Function

KEGG gene cross-reference

ath:AT1G70690

ath:AT2G01660

ath:AT3G22060

ath:AT3G60720

ath:AT5G37660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.728

Rank 1 · TkA05G362010 · TK1151

Extracellular0.119

Rank 2 · TkA05G362010 · TK1151

Endoplasmic reticulum0.088

Rank 3 · TkA05G362010 · TK1151

Cytoplasm0.072

Rank 4 · TkA05G362010 · TK1151

Lysosome / Vacuole0.033

Rank 5 · TkA05G362010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657Stress-antifung36-124 aa

PF26129Vwde79-108 aa

PF24973EGF_LMN_ATRN81-96 aa

PF00053EGF_laminin81-96 aa

PF01657Stress-antifung174-222 aa

PF26129Vwde177-208 aa

PF24973EGF_LMN_ATRN178-211 aa

PF00053EGF_laminin178-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G362010	`PF01657`	Stress-antifung	36	124	1.6e-27	96.7
TkA05G362010	`PF26129`	Vwde	79	108	0.039	14.3
TkA05G362010	`PF24973`	EGF_LMN_ATRN	81	96	3.9	8.4
TkA05G362010	`PF00053`	EGF_laminin	81	96	6.1	7.8
TkA05G362010	`PF01657`	Stress-antifung	174	222	1.6e-27	96.7
TkA05G362010	`PF26129`	Vwde	177	208	0.039	14.3
TkA05G362010	`PF24973`	EGF_LMN_ATRN	178	211	3.9	8.4
TkA05G362010	`PF00053`	EGF_laminin	178	211	6.1	7.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU94`	Arabidopsis thaliana	sp\|Q9ZU94\|PDLP6_ARATH Plasmodesmata-located protein 6	50.900%	Swiss-Prot	High
`Q0WPN8`	Arabidopsis thaliana	sp\|Q0WPN8\|PDLP7_ARATH Plasmodesmata-located protein 7	48.300%	Swiss-Prot	Medium
`Q8GUJ2`	Arabidopsis thaliana	sp\|Q8GUJ2\|PDLP5_ARATH Plasmodesmata-located protein 5	37.300%	Swiss-Prot	Medium
`Q6NKQ9`	Arabidopsis thaliana	sp\|Q6NKQ9\|PDLP8_ARATH Plasmodesmata-located protein 8	36.000%	Swiss-Prot	Medium
`Q9LV60`	Arabidopsis thaliana	sp\|Q9LV60\|CRR55_ARATH Cysteine-rich repeat secretory protein 55	23.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card