TkA05G358620 | RubberDandelionOmics

Gene overview

TkA05G358620

Reference: TK1151 Chr: Chr05 Coordinates: 89009367-89013240 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1977 bp · TkA05G358620|TK1151|cDNA

TTTGTCCCCAAGGCATCTTATTAATTTTAGTTCTTATATACACTCGTCGTACCAGCAAGAACCAAGGTGGAACTGTACAAACAGAGCCCTATTATTGGTGCTTCAACTTTGCTGGCTCACATCACCTCTCCCATACCCTTTATAGGTTTTCTGAAAATGTTAAAAAGCATTATAGTTCGTAAGCATGAGCTGTTTGGGGCAAATTATCTCATTTTTTGTATAGTTTATGGGGTTTTGTGATCTTAGCTAACTTGTATATT...

CDS

Download CDS FASTA

1200 bp · TkA05G358620|TK1151|CDS

ATGTATGTAGTGGACAGCAGAGGAGGAGCCATAGCATGCATGCTTCTCGCACTCTTCTTCTTAGGAACATGGCCCGCCATTCTAACTCTCTTAGAAAGACGCGGCCGACTTCCTCAACACACTTACCTCGATTACACAATCACCAATATTTTAGCCGCTGTCATAATCGCTTTTACATTCGGAGAATTCGGCCATACCAATGACGATAAACCCAATTTCTTAATCCAGCTTTCTCAGAATAATTGGCCAAGCGTGCTATT...

Protein

Download Protein FASTA

399 aa · TkA05G358620|TK1151|PROTEIN

MYVVDSRGGAIACMLLALFFLGTWPAILTLLERRGRLPQHTYLDYTITNILAAVIIAFTFGEFGHTNDDKPNFLIQLSQNNWPSVLFAMAGGVVLSLGNLSTQYAWAFVGLSVTEVMTSSITVVIGTTLNYFLDDKINRAEILFPGVACFLIAVCLGSAVHASNAKDNKVKLEKLQAAKNGSISNGSKTISKNDLENGISKPEKAKAGTAGFLIELESRRSIKVFGRSTLIGLGICLFAGICFSLFSPAFNLATNDQWKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G358620`
TK1151 ID	TkA05G358620
OH-1004 ID	LXL04_021157
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 99.501 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G358620

Location Chr05:89009367-89013240 (+)

Description Similar to UPS2: Ureide permease 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03530`	Proton-coupled transporter that transports a wide spectrum of oxo derivatives of heterocyclic nitrogen compounds, including allantoin, uric acid and xanthine, but not adenine.	UPS1 and UPS2 from Arabidopsis mediate high affinity transport of uracil and 5-fluorouracil.2004 · DOI: 10.1074/jbc.m405433200
`At2g03590`	Proton-coupled transporter that transports a wide spectrum of oxo derivatives of heterocyclic nitrogen compounds, including allantoin, uric acid and xanthine, but not adenine.	A novel superfamily of transporters for allantoin and other oxo derivatives of nitrogen heterocyclic compounds in Arabidopsis.2002 · DOI: 10.1105/tpc.010458 UPS1 and UPS2 from Arabidopsis mediate high affinity transport of uracil and 5-fluorouracil.2004 · DOI: 10.1074/jbc.m405433200 Heterologous expression of a plant uracil transporter in yeast: improvement of plasma membrane targeting in mutants of the Rsp5p ubiquitin protein ligase.2006 · DOI: 10.1002/biot.200500034
`At2g03520`	Proton-coupled transporter that transports a wide spectrum of oxo derivatives of heterocyclic nitrogen compounds.	No verified direct reference in this release
`At1g26440`	Proton-coupled transporter that transports a wide spectrum of oxo derivatives of heterocyclic nitrogen compounds, including allantoin, uric acid and xanthine, but not adenine.	Comparative studies on Ureide Permeases in Arabidopsis thaliana and analysis of two alternative splice variants of AtUPS5.2006 · DOI: 10.1007/s00425-006-0315-z

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021157 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0015720 allantoin transport Biological Process

GO:0015857 uracil transport Biological Process

GO:0043100 pyrimidine nucleobase salvage Biological Process

GO:0071705 nitrogen compound transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

GO:0016020 membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT1G26440

ath:AT2G03520

ath:AT2G03530

ath:AT2G03590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.442

Rank 1 · TkA05G358620 · TK1151

Lysosome / Vacuole0.192

Rank 2 · TkA05G358620 · TK1151

Endoplasmic reticulum0.174

Rank 3 · TkA05G358620 · TK1151

Cytoplasm0.160

Rank 4 · TkA05G358620 · TK1151

Golgi apparatus0.141

Rank 5 · TkA05G358620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10754DUF256913-65 aa

PF07168Ureide_permease41-393 aa

PF04087DUF38945-111 aa

PF06800Sugar_transport74-171 aa

PF07857TMEM14487-392 aa

PF10754DUF2569107-150 aa

PF07784DUF1622112-136 aa

PF04087DUF389116-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G358620	`PF10754`	DUF2569	13	65	0.019	16.2
TkA05G358620	`PF07168`	Ureide_permease	41	393	4.2e-191	635.1
TkA05G358620	`PF04087`	DUF389	45	111	0.0045	17.8
TkA05G358620	`PF06800`	Sugar_transport	74	171	7.8e-05	22.9
TkA05G358620	`PF07857`	TMEM144	87	392	0.00025	20.9
TkA05G358620	`PF10754`	DUF2569	107	150	0.019	16.2
TkA05G358620	`PF07784`	DUF1622	112	136	0.22	12.2
TkA05G358620	`PF04087`	DUF389	116	168	0.0045	17.8
TkA05G358620	`PF04087`	DUF389	211	252	0.0045	17.8
TkA05G358620	`PF07784`	DUF1622	223	250	0.22	12.2
TkA05G358620	`PF10754`	DUF2569	233	308	0.019	16.2
TkA05G358620	`PF06800`	Sugar_transport	274	293	7.8e-05	22.9
TkA05G358620	`PF04087`	DUF389	282	377	0.0045	17.8
TkA05G358620	`PF06800`	Sugar_transport	318	394	7.8e-05	22.9
TkA05G358620	`PF10754`	DUF2569	349	387	0.019	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQ89`	Arabidopsis thaliana	sp\|Q9ZQ89\|UPS2_ARATH Ureide permease 2	76.000%	Swiss-Prot	High
`Q9ZPR7`	Arabidopsis thaliana	sp\|Q9ZPR7\|UPS1_ARATH Ureide permease 1	76.400%	Swiss-Prot	High
`Q9ZQ88`	Arabidopsis thaliana	sp\|Q9ZQ88\|UPS4_ARATH Ureide permease 4	70.600%	Swiss-Prot	High
`Q93Z75`	Arabidopsis thaliana	sp\|Q93Z75\|UPS5_ARATH Ureide permease 5	66.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card