TkA05G357920 | RubberDandelionOmics

Gene overview

TkA05G357920

Reference: TK1151 Chr: Chr05 Coordinates: 88798528-88802827 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2845 bp · TkA05G357920|TK1151|cDNA

GAAAAACGATTAACCGAAATCACTGGACTCTCTTTCTCTTTCTCCTCCCAGAGAAACTGCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTAATTGTCAATGGTGAATCAGAACTGCTGTTGAGCGTTATCCCCTAAAAAGCTTAACTGAATCTCCGCATCTGCGTAAACACATTCATCTCTATCTATTCAACACTTTCAACCGCCAGGTTTGATCTGAAGATATTTCTGCTGGGATTTGGTTATTGAACTGGA...

CDS

Download CDS FASTA

1266 bp · TkA05G357920|TK1151|CDS

ATGAGAAGGCGCTTGATTAAAAAACTGTGTATGGTTTTTGGCCCTAGACTGCCAAGGATATGGTTGATCCTTTGTCTTGCTAGTGTCTTTGTACTCATCGTTTTCTCCAGTTCTTCTTCTACTCCCATTGATTCTGTCACATTGACTGTGAAGCCAAACATTTATGCAAATTACAGAAGACTAAAAGAGCAAGCAATAAACGACTACTTGGATTTAACCAGTTTATCTTCAGGAACCAGTAACCTGAAAGATCTTAAACT...

Protein

Download Protein FASTA

421 aa · TkA05G357920|TK1151|PROTEIN

MRRRLIKKLCMVFGPRLPRIWLILCLASVFVLIVFSSSSSTPIDSVTLTVKPNIYANYRRLKEQAINDYLDLTSLSSGTSNLKDLKLCGKEREHYVPCYNVSANLLTGFTNGDEFDRHCEVSQGEPFCLVRPPKDYKTPLSWPVGRDVIWNENVKITKDQFLSSGSMTKRLMLMEENQISFHSDDGLMFDGVKDYSHQVAEMIGLGSDTEFHQAGVHTVLDVGCGFGSFGAHLLSLKLMTVCMAAYELTGSQVQISLERG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G357920`
TK1151 ID	TkA05G357920
OH-1004 ID	LXL04_030121
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	47.200
Protein coverage (%)	TK1151 88.361 / OH-1004 52.239 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G357920

Location Chr05:88798528-88802827 (+)

Description Similar to QUA2: Probable pectin methyltransferase QUA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03480`	Probable methyltransferase PMT5.	No verified direct reference in this release
`At1g13860`	Probable methyltransferase PMT4.	No verified direct reference in this release
`At1g78240`	May be involved in the synthesis of homogalacturonan.	Homogalacturonan synthesis in Arabidopsis thaliana requires a Golgi-localized protein with a putative methyltransferase domain.2007 · DOI: 10.1111/j.1365-313x.2007.03086.x The TUMOROUS SHOOT DEVELOPMENT2 gene of Arabidopsis encoding a putative methyltransferase is required for cell adhesion and co-ordinated plant development.2007 · DOI: 10.1111/j.1365-313x.2007.03123.x The OSU1/QUA2/TSD2-encoded putative methyltransferase is a critical modulator of carbon and nitrogen nutrient balance response in Arabidopsis.2008 · DOI: 10.1371/journal.pone.0001387
`At5g14430`	Probable methyltransferase PMT9.	No verified direct reference in this release
`At1g04430`	Probable methyltransferase PMT8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030121 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007155 cell adhesion Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0010289 homogalacturonan biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G04430

ath:AT1G13860

ath:AT1G78240

ath:AT2G03480

ath:AT3G23300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.723

Rank 1 · TkA05G357920 · TK1151

Endoplasmic reticulum0.087

Rank 2 · TkA05G357920 · TK1151

Extracellular0.071

Rank 3 · TkA05G357920 · TK1151

Cell membrane0.066

Rank 4 · TkA05G357920 · TK1151

Cytoplasm0.046

Rank 5 · TkA05G357920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_2995-402 aa

PF13489Methyltransf_23217-316 aa

PF05175MTS217-235 aa

PF13847Methyltransf_31218-319 aa

PF01209Ubie_methyltran218-319 aa

PF13649Methyltransf_25219-311 aa

PF08241Methyltransf_11220-315 aa

PF08242Methyltransf_12220-313 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G357920	`PF03141`	Methyltransf_29	95	402	2.4e-71	241.6
TkA05G357920	`PF13489`	Methyltransf_23	217	316	0.039	14.4
TkA05G357920	`PF05175`	MTS	217	235	0.31	11.3
TkA05G357920	`PF13847`	Methyltransf_31	218	319	5e-05	23.8
TkA05G357920	`PF01209`	Ubie_methyltran	218	319	0.2	11.7
TkA05G357920	`PF13649`	Methyltransf_25	219	311	1.3e-07	32.9
TkA05G357920	`PF08241`	Methyltransf_11	220	315	3.1e-08	34.9
TkA05G357920	`PF08242`	Methyltransf_12	220	313	0.0071	17.8
TkA05G357920	`PF05175`	MTS	299	315	0.31	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3EC77`	Arabidopsis thaliana	sp\|Q3EC77\|PMT5_ARATH Probable methyltransferase PMT5	60.600%	Swiss-Prot	High
`Q8GYW9`	Arabidopsis thaliana	sp\|Q8GYW9\|PMT4_ARATH Probable methyltransferase PMT4	59.700%	Swiss-Prot	High
`Q9C9Q8`	Arabidopsis thaliana	sp\|Q9C9Q8\|PMTT_ARATH Probable pectin methyltransferase QUA2	50.300%	Swiss-Prot	High
`Q8VZV7`	Arabidopsis thaliana	sp\|Q8VZV7\|PMT9_ARATH Probable methyltransferase PMT9	30.700%	Swiss-Prot	Medium
`Q940J9`	Arabidopsis thaliana	sp\|Q940J9\|PMT8_ARATH Probable methyltransferase PMT8	31.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card