Gene Card
Gene overview
cDNA / CDS / Protein Sequences
360 bp · TkA05G356740|TK1151|cDNA
ATGGGTGACGATCAGTATGATCGGAGATTCGTGAGTAAGCTGTGTGATAAAAGATATCCAAGTGGGAAATCATTAGGTAGAATTAAGACATCTCATCTAATCGCTTATGCTGCTGCTACTAATTCAGCTGAATCAGACCACAAATTCGAACCCATGAAAAAGCTTCCTACTTTGATCATCAACGGAAGCGGAAAACGGAGACGGAAAGGGAAATGGAGACATAAAATGGGAATCCTAGTAATTACGGATTACGAGAGAAC...
360 bp · TkA05G356740|TK1151|CDS
ATGGGTGACGATCAGTATGATCGGAGATTCGTGAGTAAGCTGTGTGATAAAAGATATCCAAGTGGGAAATCATTAGGTAGAATTAAGACATCTCATCTAATCGCTTATGCTGCTGCTACTAATTCAGCTGAATCAGACCACAAATTCGAACCCATGAAAAAGCTTCCTACTTTGATCATCAACGGAAGCGGAAAACGGAGACGGAAAGGGAAATGGAGACATAAAATGGGAATCCTAGTAATTACGGATTACGAGAGAAC...
Protein
Download Protein FASTA119 aa · TkA05G356740|TK1151|PROTEIN
MGDDQYDRRFVSKLCDKRYPSGKSLGRIKTSHLIAYAAATNSAESDHKFEPMKKLPTLIINGSGKRRRKGKWRHKMGILVITDYERTLKRTGGESVLRFQLHLSQTRKSASNVAKGFSL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G356740 |
|---|---|
| TK1151 ID | TkA05G356740 |
| OH-1004 ID | LXL04_021144 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 98.400 |
| Protein coverage (%) | TK1151 53.782 / OH-1004 14.318Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G356740 |
|---|---|
| Location | Chr05:88486098-88486457 (-) |
| Description | Similar to ZAT4: Zinc finger protein ZAT4 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006950 response to stress Biological Process GO:0006970 response to osmotic stress Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009611 response to wounding Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0010200 response to chitin Biological Process GO:0010224 response to UV-B Biological Process GO:0042631 cellular response to water deprivation Biological Process GO:1902074 response to salt Biological Process |
| KEGG gene cross-reference | ath:AT1G02030 ath:AT2G28200 ath:AT2G45120 ath:AT3G53600 ath:AT3G60580 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13912zf-C2H2_613-26 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G356740 | PF13912 | zf-C2H2_6 | 13 | 26 | 0.14 | 12.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.