RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G353930
Reference: TK1151 Chr: Chr05 Coordinates: 87686557-87690082 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1926 bp · TkA05G353930|TK1151|cDNA

GGGAAATACGCTTTTTTATAATATTTAAATTCTTATAAATCGGTTGAAAAAAGTAACAGATGCATCGTGCCCACTTCTACAACCCAGAAAAACAGCGAATCAAATATTTAACATCATTTCCCCATCTCTGATCTGAGAAATTGAATGAGTGGGAGCGAAGGAAGCTCTGGACATTCAGCCGGAGATGCGACGGTGCCGGCGGCGGGGAAGAAGAAGGAAAAGGCCAAAGTGAGCCGAACGTCGTTGATACTGTGGCACGC...

CDS

Download CDS FASTA

1296 bp · TkA05G353930|TK1151|CDS

ATGAGTGGGAGCGAAGGAAGCTCTGGACATTCAGCCGGAGATGCGACGGTGCCGGCGGCGGGGAAGAAGAAGGAAAAGGCCAAAGTGAGCCGAACGTCGTTGATACTGTGGCACGCGCACCAGAACGATGCAGCTGCCGTGAGAAAGCTATTGGAGGAAGATCGGTCTTTGGTTCAAGCCAGGGATTATGATAATCGAACTCCGCTTCATGTTGCTTCGCTTCATGGATGGATCGAAGTTGCGAAATGCTTAATTGAGTA...

Protein

Download Protein FASTA

431 aa · TkA05G353930|TK1151|PROTEIN

MSGSEGSSGHSAGDATVPAAGKKKEKAKVSRTSLILWHAHQNDAAAVRKLLEEDRSLVQARDYDNRTPLHVASLHGWIEVAKCLIEYGADVNAQDRWKNTPLADAEGARKYNMIELLKSYGGLSYGQNGSHFEPRPVPPPLSNKCDWEIDPVELDFTNSHMIGKGSFGEIVRACWRGTPVAVKRILPSLSDDKLVVQDFRHEVNLLVKLRHPNIVQFLGAVTEKKPLMLITEYLRGGDLHQCLKEKGALSPTTAVNFALD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G353930
TK1151 IDTkA05G353930
OH-1004 IDLXL04_021096
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G353930
LocationChr05:87686557-87690082 (+)
DescriptionSimilar to ILK1: Integrin-linked protein kinase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g14000 Serine/threonine protein kinase which may function as an adapter protein for BRL2. No verified direct reference in this release
At4g18950 Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues (By similarity). No verified direct reference in this release
At2g43850 Functions as a link between plant defense pathways, stress responses and potassium homeostasis. No verified direct reference in this release
At4g38470 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
At2g17700 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021096 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006970 response to osmotic stress Biological Process
GO:0007165 signal transduction Biological Process
GO:0007229 integrin-mediated signaling pathway Biological Process
GO:0009637 response to blue light Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0010305 leaf vascular tissue pattern formation Biological Process
GO:0010828 positive regulation of D-glucose transmembrane transport Biological Process
GO:0045087 innate immune response Biological Process
KEGG gene cross-reference
ath:AT1G14000
ath:AT2G17700
ath:AT2G43850
ath:AT4G18950
ath:AT4G35780
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.580
Rank 1 · TkA05G353930 · TK1151
Cell membrane0.392
Rank 2 · TkA05G353930 · TK1151
Nucleus0.294
Rank 3 · TkA05G353930 · TK1151
Golgi apparatus0.064
Rank 4 · TkA05G353930 · TK1151
Mitochondrion0.041
Rank 5 · TkA05G353930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13606Ank_334-52 aa
PF13637Ank_436-85 aa
PF12796Ank_237-120 aa
PF00023Ank39-62 aa
PF13857Ank_539-54 aa
PF13857Ank_557-102 aa
PF00023Ank64-96 aa
PF13606Ank_364-93 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G353930PF13606Ank_334521.6e-0731.7
TkA05G353930PF13637Ank_436852.8e-0834.5
TkA05G353930PF12796Ank_2371201.4e-1042.3
TkA05G353930PF00023Ank39624e-0937.0
TkA05G353930PF13857Ank_539541.2e-0629.4
TkA05G353930PF13857Ank_5571021.2e-0629.4
TkA05G353930PF00023Ank64964e-0937.0
TkA05G353930PF13606Ank_364931.6e-0731.7
TkA05G353930PF13637Ank_4701022.8e-0834.5
TkA05G353930PF23745ANK_LRRK2721190.1512.7
TkA05G353930PF00023Ank991174e-0937.0
TkA05G353930PF00069Pkinase1574122.9e-58198.0
TkA05G353930PF07714PK_Tyr_Ser-Thr1594144.9e-64216.8
TkA05G353930PF23745ANK_LRRK21702150.1512.7
TkA05G353930PF13857Ank_51721861.2e-0629.4
TkA05G353930PF00023Ank2092184e-0937.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9XI87Arabidopsis thalianasp|Q9XI87|VIK_ARATH Serine/threonine-protein kinase VIK84.300%Swiss-ProtHigh
Q93Z30Arabidopsis thalianasp|Q93Z30|BHP_ARATH Serine/threonine-protein kinase 1242.800%Swiss-ProtMedium
F4IS56Arabidopsis thalianasp|F4IS56|ILK1_ARATH Integrin-linked protein kinase 142.100%Swiss-ProtMedium
F4JTP5Arabidopsis thalianasp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY4638.300%Swiss-ProtMedium
O22558Arabidopsis thalianasp|O22558|STY8_ARATH Serine/threonine-protein kinase STY834.600%Swiss-ProtMedium

JBrowse

View in Genome Browser