TkA05G350330 | RubberDandelionOmics

Gene overview

TkA05G350330

Reference: TK1151 Chr: Chr05 Coordinates: 86761022-86763346 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1187 bp · TkA05G350330|TK1151|cDNA

AAATGGAAAAACATAGTTTGCTGAACAACCCAATAAACGTCTTACATTCTTTTCGACAAAAAGCCCTCAACTTGGGGCGTTCAATTTTTCTTTGCGAAGCGAGTAATCGATAAAAATCACAAAATGGAATCCCCGAGTTGGCTATGGTAACAGCGTAGGTGATTGATCAGATCCGCTGCTGGTTCCATGGTTCAGCAACAAAGCCAGCCGAGATCCAAGGCCCTCCACAAGATCGGACTGGCGTCGGTATCTGCAATGGT...

CDS

Download CDS FASTA

906 bp · TkA05G350330|TK1151|CDS

ATGGTTCAGCAACAAAGCCAGCCGAGATCCAAGGCCCTCCACAAGATCGGACTGGCGTCGGTATCTGCAATGGTGGCGGAAACCTCCACCTTCCCCATAGATATAACCAAGACGAGGCTTCAATTACACGCCATATCCCTCTCAACGACTCGCCGACTCTCGGCCTTTCAGGTCGCCACCGACATTGTACGCAACGAAGGCGTAACAGGACTATACAGGGGCTTATCACCTGCACTTATCAGACACATTTTCTACACACC...

Protein

Download Protein FASTA

301 aa · TkA05G350330|TK1151|PROTEIN

MVQQQSQPRSKALHKIGLASVSAMVAETSTFPIDITKTRLQLHAISLSTTRRLSAFQVATDIVRNEGVTGLYRGLSPALIRHIFYTPIRTVGYEQLRHAFLTDDSQSLSLPSKALIGGLSGVIAQVVASPADLVKVRMQADGQKVNQGLPPRYKTPLNAFHKIIKTEGFSGLWRGVIPNIQRAFLVNMGELACYDHAKTFIIQNKIANDNIYAHTLASMMSGLSATTISCPADVVKTRMMNQEGKVKYRNLYDCVVKTVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G350330`
TK1151 ID	TkA05G350330
OH-1004 ID	LXL04_021070
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G350330

Location Chr05:86761022-86763346 (+)

Description Similar to PUMP3: Mitochondrial uncoupling protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14140`	PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021070 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009409 response to cold Biological Process

GO:0010917 negative regulation of mitochondrial membrane potential Biological Process

GO:0035356 intracellular triglyceride homeostasis Biological Process

GO:0046324 regulation of D-glucose import across plasma membrane Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0051562 negative regulation of mitochondrial calcium ion concentration Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0045177 apical part of cell Cellular Component

GO:0015078 proton transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G14140

ddi:DDB_G0283333

hsa:9481

mmu:74011

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.911

Rank 1 · TkA05G350330 · TK1151

Cytoplasm0.028

Rank 2 · TkA05G350330 · TK1151

Nucleus0.022

Rank 3 · TkA05G350330 · TK1151

Cell membrane0.014

Rank 4 · TkA05G350330 · TK1151

Plastid0.009

Rank 5 · TkA05G350330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr11-102 aa

PF00153Mito_carr108-204 aa

PF18405SLC25_like113-135 aa

PF18405SLC25_like207-242 aa

PF00153Mito_carr209-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G350330	`PF00153`	Mito_carr	11	102	4.2e-73	241.9
TkA05G350330	`PF00153`	Mito_carr	108	204	4.2e-73	241.9
TkA05G350330	`PF18405`	SLC25_like	113	135	0.055	13.3
TkA05G350330	`PF18405`	SLC25_like	207	242	0.055	13.3
TkA05G350330	`PF00153`	Mito_carr	209	295	4.2e-73	241.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI74`	Arabidopsis thaliana	sp\|Q9XI74\|PUMP3_ARATH Mitochondrial uncoupling protein 3	69.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card