TkA05G348600 | RubberDandelionOmics

Gene overview

TkA05G348600

Reference: TK1151 Chr: Chr05 Coordinates: 86336385-86337625 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · TkA05G348600|TK1151|cDNA

GGTAAGCAAATTGTTACATCTTGGTGGGATCATTCGAAATTATTCGTCAACAAAGATTGGCCTGAAATCAACAAGTTTAAGGAAATTTATCTTGCTCGGTACGGATCTGAGGAATCATCAACTGCAGTTTCTGAACACTCTTCACCATCAATTTCTAACAATGATGATTTTTGGACAAAGCATCCAATTAAATATATCAATGAAGTTTTGGATCCAATCCAGATTCAAACATTCATAATCGTTGGAAAAATTGTATCAAT...

CDS

Download CDS FASTA

816 bp · TkA05G348600|TK1151|CDS

GGTAAGCAAATTGTTACATCTTGGTGGGATCATTCGAAATTATTCGTCAACAAAGATTGGCCTGAAATCAACAAGTTTAAGGAAATTTATCTTGCTCGGTACGGATCTGAGGAATCATCAACTGCAGTTTCTGAACACTCTTCACCATCAATTTCTAACAATGATGATTTTTGGACAAAGCATCCAATTAAATATATCAATGAAGTTTTGGATCCAATCCAGATTCAAACATTCATAATCGTTGGAAAAATTGTATCAAT...

Protein

Download Protein FASTA

271 aa · TkA05G348600|TK1151|PROTEIN

GKQIVTSWWDHSKLFVNKDWPEINKFKEIYLARYGSEESSTAVSEHSSPSISNNDDFWTKHPIKYINEVLDPIQIQTFIIVGKIVSIRQDQEWYYLSCTACPSKVTEKWLTKDLPDGSKSDPSMVFECKNRRCQKLNKDPIPRFKIPVVVQDSNGSIVLTLFDHDAMSLVRHSCTALVEKINRLEFNLALFSDELNVLKNLHLAFKIVSGQYNVTNQNTQYSISKVSNDTELIKELMQKLNMQVFGIYYFSILQKKAFYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G348600`
TK1151 ID	TkA05G348600
OH-1004 ID	LXL04_026895
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.800
Protein coverage (%)	TK1151 92.620 / OH-1004 61.975 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G348600`
Location	Chr05:86336385-86337625 (-)
Description	No functional description available
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026895` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0007140 male meiotic nuclear division Biological Process GO:0009555 pollen development Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0005662 DNA replication factor A complex Cellular Component GO:0003684 damaged DNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0043047 single-stranded telomeric DNA binding Molecular Function
KEGG gene cross-reference	dosa:Os02g0776800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.948

Rank 1 · TkA05G348600 · TK1151

Cytoplasm0.129

Rank 2 · TkA05G348600 · TK1151

Cell membrane0.019

Rank 3 · TkA05G348600 · TK1151

Mitochondrion0.017

Rank 4 · TkA05G348600 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA05G348600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00961LAGLIDADG_174-99 aa

PF08646Rep_fac-A_C78-226 aa

PF00961LAGLIDADG_1180-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G348600	`PF00961`	LAGLIDADG_1	74	99	0.064	14.9
TkA05G348600	`PF08646`	Rep_fac-A_C	78	226	6.9e-09	36.4
TkA05G348600	`PF00961`	LAGLIDADG_1	180	242	0.064	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card