TkA05G344400 | RubberDandelionOmics

Gene overview

TkA05G344400

Reference: TK1151 Chr: Chr05 Coordinates: 85351343-85355796 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2271 bp · TkA05G344400|TK1151|cDNA

CTCCTCAATTCTTTATTTCTCCCAGATTTGCTTTGATCCTACAAGCTACTTTCCAGATTTTTTGGTCGCTCCCAATCGAGTTCCTGCGTATATGAGACTGAGATCTCCGCCAATCTGATCTGGTTTTCCAACGACGACCTCAAGAGTATATTGTGCTGAATCTATGCTCGCGGTTCCTTCTGCCTGAGTTTATTTCTCAGAGATTAGTTCTGTTTGTTCCCTGATGCGATTGGCTGCATCATGGCAACAAAGGGGAATTC...

CDS

Download CDS FASTA

1827 bp · TkA05G344400|TK1151|CDS

ATGGCAACAAAGGGGAATTCAGGAGAAAACAGGGCTAGAAGCTCCATTACAATATTCATAGTTATTGGTTTATGTTGTTTCTTCTACCTATTGGGGGCATGGCAAAGAAGTGGATACGGAAAGGGAGACAGCATAGCTTTACAGATGACCAAAACAGGTGCAGAATGCAACATTCTCCCAGACCTAAACTTTGAAACACATCACAGTGGCGATACCGTAATAATCGACAACACAGTCACCAAACTCAAACAGTTCAAGCC...

Protein

Download Protein FASTA

608 aa · TkA05G344400|TK1151|PROTEIN

MATKGNSGENRARSSITIFIVIGLCCFFYLLGAWQRSGYGKGDSIALQMTKTGAECNILPDLNFETHHSGDTVIIDNTVTKLKQFKPCSAKYTDYTPCHDQKRAMTFPRHDMIYRERHCPPQEQKLKCLVPAPKGYVTPFSWPKSRDYVPFANAPYKALTVEKAIQNWIQYEGNVFRFPGGGTQFPQGADAYIDQLASVIPIDNGTVRTALDTGCGVASWGAYLWKRNVVTMSFAPRDNHEAQVQFALERGVPAIVGVLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G344400`
TK1151 ID	TkA05G344400
OH-1004 ID	LXL04_029684
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	68.700
Protein coverage (%)	TK1151 97.368 / OH-1004 90.769 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G344400

Location Chr05:85351343-85355796 (-)

Description Similar to At4g18030: Probable methyltransferase PMT14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26850`	Probable methyltransferase PMT2.	No verified direct reference in this release
`At4g18030`	Probable methyltransferase PMT14.	No verified direct reference in this release
`At4g10440`	Probable methyltransferase PMT17.	No verified direct reference in this release
`At1g33170`	Probable methyltransferase PMT18.	No verified direct reference in this release
`At4g00750`	Probable methyltransferase PMT15.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029684 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

KEGG gene cross-reference

ath:AT1G26850

ath:AT1G33170

ath:AT2G45750

ath:AT4G10440

ath:AT4G18030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.759

Rank 1 · TkA05G344400 · TK1151

Cell membrane0.076

Rank 2 · TkA05G344400 · TK1151

Endoplasmic reticulum0.069

Rank 3 · TkA05G344400 · TK1151

Extracellular0.059

Rank 4 · TkA05G344400 · TK1151

Cytoplasm0.038

Rank 5 · TkA05G344400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_2994-595 aa

PF13847Methyltransf_31209-342 aa

PF08241Methyltransf_11211-305 aa

PF13649Methyltransf_25211-302 aa

PF08242Methyltransf_12211-303 aa

PF20922Anamorsin_N286-309 aa

PF13649Methyltransf_25499-550 aa

PF08242Methyltransf_12510-551 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G344400	`PF03141`	Methyltransf_29	94	595	2.6e-224	746.2
TkA05G344400	`PF13847`	Methyltransf_31	209	342	2.8e-08	34.4
TkA05G344400	`PF08241`	Methyltransf_11	211	305	4.4e-11	44.0
TkA05G344400	`PF13649`	Methyltransf_25	211	302	2.3e-09	38.6
TkA05G344400	`PF08242`	Methyltransf_12	211	303	0.0056	18.1
TkA05G344400	`PF20922`	Anamorsin_N	286	309	0.062	13.7
TkA05G344400	`PF13649`	Methyltransf_25	499	550	2.3e-09	38.6
TkA05G344400	`PF08242`	Methyltransf_12	510	551	0.0056	18.1
TkA05G344400	`PF13847`	Methyltransf_31	514	558	2.8e-08	34.4
TkA05G344400	`PF08241`	Methyltransf_11	515	554	4.4e-11	44.0
TkA05G344400	`PF20922`	Anamorsin_N	536	561	0.062	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DFI7`	Arabidopsis thaliana	sp\|B9DFI7\|PMT2_ARATH Probable methyltransferase PMT2	74.000%	Swiss-Prot	High
`Q94EJ6`	Arabidopsis thaliana	sp\|Q94EJ6\|PMTE_ARATH Probable methyltransferase PMT14	66.200%	Swiss-Prot	High
`Q9SZX8`	Arabidopsis thaliana	sp\|Q9SZX8\|PMTH_ARATH Probable methyltransferase PMT17	53.000%	Swiss-Prot	High
`Q9C884`	Arabidopsis thaliana	sp\|Q9C884\|PMTI_ARATH Probable methyltransferase PMT18	52.700%	Swiss-Prot	High
`Q9ZPH9`	Arabidopsis thaliana	sp\|Q9ZPH9\|PMTF_ARATH Probable methyltransferase PMT15	51.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card