TkA05G342930 | RubberDandelionOmics

Gene overview

TkA05G342930

Reference: TK1151 Chr: Chr05 Coordinates: 84978493-84989365 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2481 bp · TkA05G342930|TK1151|cDNA

AGAAGAATGGTTCCGCAAAACACGCAAACATAAAAACGAATATCTCGTAATACGATAAAATGGATGCGATAAATTGAAAAGACTCGATCACAGAGCCGTGGAGAAAACGAGTCAATTAACTCGCCCGCAAAAAGGAAAAAAATAAAACACGTTCAGACCGGCAATTGCCGGTTTCCGGTCATCTCCCACTTCCCTAAATAAAATAGTCTACCCGGTGAGGCGACTCGAACACAAACTGAAAAAAGGATTGAGTTGGTTGT...

CDS

Download CDS FASTA

1341 bp · TkA05G342930|TK1151|CDS

ATGTTGGAAGATCGATCTTGTTTTGTATCAAGAAGTTACAGTCGCGAAAGGGACAATAGCCACAATACTTGGAGTTATATGAGCAATTACAGTATAGAAAGACTAGAATCCCAACAAGAAAAACGTCCATTAGAACACGATGAAAACGAAGAACTCGATCATGCCCGAAAAGTCTCGAAACAATCAAACAATTTACAAAACCTACAACTCGAATTAGGGTGCCTCGAGTTTTCTAATCATTCGAATAATCAAGATCAAGC...

Protein

Download Protein FASTA

446 aa · TkA05G342930|TK1151|PROTEIN

MLEDRSCFVSRSYSRERDNSHNTWSYMSNYSIERLESQQEKRPLEHDENEELDHARKVSKQSNNLQNLQLELGCLEFSNHSNNQDQAGDSSSLINGLDRDNSLTCLMKCSRSNYGSIASLNRTFRDLVRSGELYRLRRKNGIIEHWVYFSCHLVEWESFDPITSRWMHLPTMTSNPCFQFSDKESLAVGTELLVLGKEVLDHVIYKYSLLTNSWSLGRNMNFPRCLFGSASLGEKAIVAGGCDPNGRIVNSAELYDSELG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G342930`
TK1151 ID	TkA05G342930
OH-1004 ID	LXL04_021023
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G342930

Location Chr05:84978493-84989365 (+)

Description Similar to SKIP11: F-box/kelch-repeat protein SKIP11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26930`	F-box/kelch-repeat protein At1g26930.	No verified direct reference in this release
`At2g02870`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g74510`	F-box/kelch-repeat protein At1g74510.	No verified direct reference in this release
`At5g60570`	F-box/kelch-repeat protein At5g60570.	No verified direct reference in this release
`At3g27150`	F-box/kelch-repeat protein At3g27150.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021023 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G26930

ath:AT1G74510

ath:AT2G02870

ath:AT3G27150

ath:AT5G60570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.761

Rank 1 · TkA05G342930 · TK1151

Cytoplasm0.225

Rank 2 · TkA05G342930 · TK1151

Cell membrane0.059

Rank 3 · TkA05G342930 · TK1151

Plastid0.036

Rank 4 · TkA05G342930 · TK1151

Endoplasmic reticulum0.032

Rank 5 · TkA05G342930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01344Kelch_121-29 aa

PF00646F-box54-65 aa

PF00646F-box97-135 aa

PF03478Beta-prop_KIB1-4146-381 aa

PF24681Kelch_KLHDC2_KLHL20_DRC7155-196 aa

PF07646Kelch_2155-170 aa

PF01344Kelch_1157-173 aa

PF24681Kelch_KLHDC2_KLHL20_DRC7160-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G342930	`PF01344`	Kelch_1	21	29	5e-30	103.4
TkA05G342930	`PF00646`	F-box	54	65	0.069	13.8
TkA05G342930	`PF00646`	F-box	97	135	0.069	13.8
TkA05G342930	`PF03478`	Beta-prop_KIB1-4	146	381	0.1	12.8
TkA05G342930	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	155	196	3.1e-10	40.5
TkA05G342930	`PF07646`	Kelch_2	155	170	1.7e-09	37.9
TkA05G342930	`PF01344`	Kelch_1	157	173	5e-30	103.4
TkA05G342930	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	160	324	3.1e-10	40.5
TkA05G342930	`PF25210`	Kelch_FKB95	171	264	4.2e-16	60.1
TkA05G342930	`PF01344`	Kelch_1	196	221	5e-30	103.4
TkA05G342930	`PF24981`	Beta-prop_ATRN-LZTR1	196	317	1e-07	32.2
TkA05G342930	`PF13964`	Beta-prop_Calicin	200	321	4e-09	36.6
TkA05G342930	`PF13415`	Beta-prop_FBX42	203	295	4.3e-08	33.8
TkA05G342930	`PF07646`	Kelch_2	204	215	1.7e-09	37.9
TkA05G342930	`PF24996`	NANM	204	242	0.00014	21.6
TkA05G342930	`PF01344`	Kelch_1	223	268	5e-30	103.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84M94`	Arabidopsis thaliana	sp\|Q84M94\|FBK15_ARATH F-box/kelch-repeat protein At1g26930	65.800%	Swiss-Prot	High
`Q8L736`	Arabidopsis thaliana	sp\|Q8L736\|SKI11_ARATH F-box/kelch-repeat protein SKIP11	64.700%	Swiss-Prot	High
`Q9CA63`	Arabidopsis thaliana	sp\|Q9CA63\|FBK29_ARATH F-box/kelch-repeat protein At1g74510	58.600%	Swiss-Prot	High
`Q9FKJ0`	Arabidopsis thaliana	sp\|Q9FKJ0\|FK132_ARATH F-box/kelch-repeat protein At5g60570	40.100%	Swiss-Prot	Medium
`Q9LI89`	Arabidopsis thaliana	sp\|Q9LI89\|FBK70_ARATH F-box/kelch-repeat protein At3g27150	34.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card