TkA05G341940 | RubberDandelionOmics

Gene overview

TkA05G341940

Reference: TK1151 Chr: Chr05 Coordinates: 84692927-84695029 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1254 bp · TkA05G341940|TK1151|cDNA

CTTTCTATTACAGCACCTTTCGGGAGCATTTTGTCCGATCTCTGAAACCGCTGTATCAAAGATTTACGCCGGATATCAAGATTTCGGCACCGATGGAGTCACACGGCGTCGGTCTCCGCCGTGTTTTGGAGCTCGCATTTTGCGTCGCCGGTATTTGGGCAGCTTATATATACCAAGGCGTTCTTCAGGAGACCGTGTCTACTAAGCGATTTGGGCCAGAGAAGGAGAGGTTCGAACATCTGGCATTCTTAAATTTGGCG...

CDS

Download CDS FASTA

1002 bp · TkA05G341940|TK1151|CDS

ATGGAGTCACACGGCGTCGGTCTCCGCCGTGTTTTGGAGCTCGCATTTTGCGTCGCCGGTATTTGGGCAGCTTATATATACCAAGGCGTTCTTCAGGAGACCGTGTCTACTAAGCGATTTGGGCCAGAGAAGGAGAGGTTCGAACATCTGGCATTCTTAAATTTGGCGCAAAGTGCAGTTTGTTTCATATGGTCATTCATGATGATAAAGCTGTGGCCCAGTGGCAGTAGTACTGGCCATGCTCCATGGTGGAGTTATTG...

Protein

Download Protein FASTA

333 aa · TkA05G341940|TK1151|PROTEIN

MESHGVGLRRVLELAFCVAGIWAAYIYQGVLQETVSTKRFGPEKERFEHLAFLNLAQSAVCFIWSFMMIKLWPSGSSTGHAPWWSYWSAGITNTIGPAMGIEALKYISYPAQVLAKSSKMIPVMVMGTLVYGIRYSFPEYLCSLLVAGGVSVFALAKTSSKTISKLANPNAPLGYGLCFLNLAFDGFTNATQDSVSTRYPKTTAWDIMLGMNLWGTLYNFLFMFGWPTAIGYQAIQFCNRHPEAAWDILYYCLCGAVGQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G341940`
TK1151 ID	TkA05G341940
OH-1004 ID	LXL04_021014
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G341940

Location Chr05:84692927-84695029 (+)

Description Similar to UTR3: UDP-galactose/UDP-glucose transporter 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14360`	Essential sugar transporter required for the transport of UDP-glucose from the cytoplasm into the Golgi and the endoplasmic reticulum.	The nucleotide sugar transporters AtUTr1 and AtUTr3 are required for the incorporation of UDP-glucose into the endoplasmic reticulum, are essential for pollen development and are needed for embryo sac progress in Arabidopsis thaliana.2010 · DOI: 10.1111/j.1365-313x.2009.04066.x
`At2g02810`	Essential sugar transporter required for the transport of UDP-galactose and UDP-glucose from the cytoplasm into the Golgi and the endoplasmic reticulum, to ensure quality control of protein folding.	Transport of UDP-galactose in plants. Identification and functional characterization of AtUTr1, an Arabidopsis thaliana UDP-galactos/UDP-glucose transporter.2002 · DOI: 10.1074/jbc.m204081200 AtUTr1, a UDP-glucose/UDP-galactose transporter from Arabidopsis thaliana, is located in the endoplasmic reticulum and up-regulated by the unfolded protein response.2006 · DOI: 10.1074/jbc.m512210200 The nucleotide sugar transporters AtUTr1 and AtUTr3 are required for the incorporation of UDP-glucose into the endoplasmic reticulum, are essential for pollen development and are needed for embryo sac progress in Arabidopsis thaliana.2010 · DOI: 10.1111/j.1365-313x.2009.04066.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021014 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0015780 nucleotide-sugar transmembrane transport Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0072334 UDP-galactose transmembrane transport Biological Process

GO:0120112 UDP-glucose transmembrane transport into endoplasmic reticulum Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005459 UDP-galactose transmembrane transporter activity Molecular Function

GO:0005460 UDP-glucose transmembrane transporter activity Molecular Function

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G14360

ath:AT2G02810

cal:CAALFM_C306980WA

ddi:DDB_G0288927

ddi:DDB_G0288929

yli:2912920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.501

Rank 1 · TkA05G341940 · TK1151

Endoplasmic reticulum0.463

Rank 2 · TkA05G341940 · TK1151

Cytoplasm0.061

Rank 3 · TkA05G341940 · TK1151

Cell membrane0.038

Rank 4 · TkA05G341940 · TK1151

Nucleus0.032

Rank 5 · TkA05G341940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24451DUF756710-38 aa

PF08449UAA14-318 aa

PF08627CRT-like49-161 aa

PF00892EamA52-153 aa

PF00892EamA209-313 aa

PF08627CRT-like226-283 aa

PF24451DUF7567234-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G341940	`PF24451`	DUF7567	10	38	0.34	11.6
TkA05G341940	`PF08449`	UAA	14	318	8.7e-78	262.3
TkA05G341940	`PF08627`	CRT-like	49	161	0.029	14.1
TkA05G341940	`PF00892`	EamA	52	153	1.3e-07	32.6
TkA05G341940	`PF00892`	EamA	209	313	1.3e-07	32.6
TkA05G341940	`PF08627`	CRT-like	226	283	0.029	14.1
TkA05G341940	`PF24451`	DUF7567	234	278	0.34	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9S6`	Arabidopsis thaliana	sp\|Q9M9S6\|UTR3_ARATH UDP-galactose/UDP-glucose transporter 3	81.900%	Swiss-Prot	High
`O64503`	Arabidopsis thaliana	sp\|O64503\|UTR1_ARATH UDP-galactose/UDP-glucose transporter 1	81.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card