TkA05G340170 | RubberDandelionOmics

Gene overview

TkA05G340170

Reference: TK1151 Chr: Chr05 Coordinates: 84236484-84245294 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2629 bp · TkA05G340170|TK1151|cDNA

CTATAATGTATACTAAAAATCTATTTGAGATAGGATTGTTGTTTTATATCTCTACCTTTTATCCCCCGTACCACTCTACACACAACCAATTTCTGCCTATATAACCTCACCTCCCCACTACTATAAATAGAAACCCTACTCTCTATCTCTCTCCTCATCGTCAGGAGTTGTGTACTTGGATTTCCCATTCACAATAAAACAATACCACAGATATGTCCATTGGAGATGATCTAAGTACCATCCAACTACTTTGAAAACTG...

CDS

Download CDS FASTA

1068 bp · TkA05G340170|TK1151|CDS

ATGCTGACTATTTTTTTGTCAATCCCAGTTTTTTTAGCCGGTTCAAGTTTTTACCGCAACAAGGTTCCCGGTGGAAGCCCTCTAACAACTATATTTAAGCATCAGGTTCTAGTTGCGTCAATGTTGAACACTTGCATTGTGAGGAACCCTAGCAACGCCATCGCGAGCATCTCTCCTCCGACATTAATTAATCGTGAAGAACAGACGGCCAACCCCACAAAGCAACCGGAAGAACCAGAAGCCCCATCGTCGAGCCTAAA...

Protein

Download Protein FASTA

355 aa · TkA05G340170|TK1151|PROTEIN

MLTIFLSIPVFLAGSSFYRNKVPGGSPLTTIFKHQVLVASMLNTCIVRNPSNAIASISPPTLINREEQTANPTKQPEEPEAPSSSLKFLNRAAMNEPACSFLRCSVLQVEEVKIVLKVLPIFGCTIMLNCCLAQLSTFSVQQASTMNTKIGNLKVPPASLPVFPVVFIILIAPVYDHIIVPFARKTTKSEMGISHLQRIGFGLLLSILAMAVAALVEIKRKRIATKTGLDTQEPLPISFLWIAFQYLFLGSADLFTLAGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G340170`
TK1151 ID	TkA05G340170
OH-1004 ID	LXL04_021010
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.700
Protein coverage (%)	TK1151 99.718 / OH-1004 61.005 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G340170

Location Chr05:84236484-84245294 (-)

Description Similar to NPF4.6: Protein NRT1/ PTR FAMILY 4.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69850`	Low-affinity proton-dependent nitrate transporter.	Identification of an abscisic acid transporter by functional screening using the receptor complex as a sensor.2012 · DOI: 10.1073/pnas.1203567109 Nitrate does not compete with abscisic acid as a substrate of AtNPF4.6/NRT1.2/AIT1 in Arabidopsis.2013 · DOI: 10.4161/psb.26624
`At1g27040`	Involved in abscisic acid transport.	No verified direct reference in this release
`At5g62730`	Protein NRT1/ PTR FAMILY 4.7.	No verified direct reference in this release
`At1g59740`	Protein NRT1/ PTR FAMILY 4.3.	No verified direct reference in this release
`At2g02040`	Peptide transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021010 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006857 oligopeptide transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0080168 abscisic acid transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G27040

ath:AT1G59740

ath:AT1G69850

ath:AT3G25260

ath:AT5G62730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.649

Rank 1 · TkA05G340170 · TK1151

Lysosome / Vacuole0.128

Rank 2 · TkA05G340170 · TK1151

Endoplasmic reticulum0.113

Rank 3 · TkA05G340170 · TK1151

Cytoplasm0.076

Rank 4 · TkA05G340170 · TK1151

Golgi apparatus0.040

Rank 5 · TkA05G340170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00854PTR23-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G340170	`PF00854`	PTR2	3	310	2.8e-63	214.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H157`	Arabidopsis thaliana	sp\|Q8H157\|PTR19_ARATH Protein NRT1/ PTR FAMILY 4.6	66.500%	Swiss-Prot	High
`Q8VYE4`	Arabidopsis thaliana	sp\|Q8VYE4\|PTR12_ARATH Protein NRT1/ PTR FAMILY 4.5	65.300%	Swiss-Prot	High
`Q9FM20`	Arabidopsis thaliana	sp\|Q9FM20\|PTR54_ARATH Protein NRT1/ PTR FAMILY 4.7	58.900%	Swiss-Prot	High
`Q93VV5`	Arabidopsis thaliana	sp\|Q93VV5\|PTR16_ARATH Protein NRT1/ PTR FAMILY 4.3	38.800%	Swiss-Prot	Medium
`P46032`	Arabidopsis thaliana	sp\|P46032\|PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3	39.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card