TkA05G339360 | RubberDandelionOmics

Gene overview

TkA05G339360

Reference: TK1151 Chr: Chr05 Coordinates: 83910097-83912263 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1408 bp · TkA05G339360|TK1151|cDNA

CTATTCCAATGTCTATATATATAAAGGAACCTCAAAGAGCCCAACCACAATTCAGTTGCAAGCATTAAGAAAGTAGCTAGCCATGGCCGCCTGCAACTCTTATAACCTTGTAAAACTCATCTCCATAGCCTTCTTCCTCACAGCTTTCTTCTCCACCGGAACCCTAGCTCAATGCAAGGACGAAACCACCAACTCCTGCAACAATAAACCCAAAGCACTGCAACTAAAACTCATCGGCATTGCTTCAATCCTCATCACCA...

CDS

Download CDS FASTA

1062 bp · TkA05G339360|TK1151|CDS

ATGGCCGCCTGCAACTCTTATAACCTTGTAAAACTCATCTCCATAGCCTTCTTCCTCACAGCTTTCTTCTCCACCGGAACCCTAGCTCAATGCAAGGACGAAACCACCAACTCCTGCAACAATAAACCCAAAGCACTGCAACTAAAACTCATCGGCATTGCTTCAATCCTCATCACCAGCATCATCGGAGTCTCTCTCCCTCTAGTCACCCGCTCTATCCCCGCCCTTAGCCCTGACCGGAGCCTCTTCATCATCATCAA...

Protein

Download Protein FASTA

353 aa · TkA05G339360|TK1151|PROTEIN

MAACNSYNLVKLISIAFFLTAFFSTGTLAQCKDETTNSCNNKPKALQLKLIGIASILITSIIGVSLPLVTRSIPALSPDRSLFIIIKAFASGIILATGFMHVLPDSFAMLRSVCLAENPWHKFPFTGFVAMLSAIFTLMVDSMATSMYTKTNSSVSAEADKVVVAGDHEMAAASGGGHHHSHLNGQRGSVGTQLLRYRVVAMVLELGIVVHSIIIGLGVGASNDICTIKPLVAALCFHQLFEGMGLGGCILQAEYKIVQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G339360`
TK1151 ID	TkA05G339360
OH-1004 ID	LXL04_020997
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G339360

Location Chr05:83910097-83912263 (-)

Description Similar to ZIP10: Probable zinc transporter 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31260`	Probably mediates zinc uptake from the rhizosphere.	No verified direct reference in this release
`At4g19690`	High-affinity iron transporter that plays a key role in the uptake of iron from the rhizosphere across the plasma membrane in the root epidermal layer.	IRT1, an Arabidopsis transporter essential for iron uptake from the soil and for plant growth.2002 · DOI: 10.1105/tpc.001388
`At5g45105`	Probably mediates zinc uptake from the rhizosphere.	No verified direct reference in this release
`At4g19680`	High-affinity iron transporter that mediates under iron- deficiency the iron uptake from the rhizosphere across the plasma membrane in the root epidermal layer.	Arabidopsis IRT2 gene encodes a root-periphery iron transporter.2001 · DOI: 10.1046/j.1365-313x.2001.01018.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0667500`	Iron transporter involved in the uptake of iron from the rhizosphere across the plasma membrane in the root epidermal layer.	Rice plants take up iron as an Fe3+-phytosiderophore and as Fe2+.2006 · DOI: 10.1111/j.1365-313x.2005.02624.x Over-expression of OsIRT1 leads to increased iron and zinc accumulations in rice.2009 · DOI: 10.1111/j.1365-3040.2009.01935.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020997 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006826 iron ion transport Biological Process

GO:0006828 manganese ion transport Biological Process

GO:0006829 zinc ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0009617 response to bacterium Biological Process

GO:0015675 nickel cation transport Biological Process

GO:0015691 cadmium ion transport Biological Process

GO:0030001 metal ion transport Biological Process

GO:0071577 zinc ion transmembrane transport Biological Process

GO:0005768 endosome Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G31260

ath:AT4G19690

dosa:Os03g0667300

dosa:Os03g0667500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.744

Rank 1 · TkA05G339360 · TK1151

Endoplasmic reticulum0.094

Rank 2 · TkA05G339360 · TK1151

Lysosome / Vacuole0.092

Rank 3 · TkA05G339360 · TK1151

Cytoplasm0.065

Rank 4 · TkA05G339360 · TK1151

Golgi apparatus0.037

Rank 5 · TkA05G339360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02535Zip47-350 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G339360	`PF02535`	Zip	47	350	1.6e-78	265.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W245`	Arabidopsis thaliana	sp\|Q8W245\|ZIP10_ARATH Probable zinc transporter 10	63.600%	Swiss-Prot	High
`Q38856`	Arabidopsis thaliana	sp\|Q38856\|IRT1_ARATH Fe(2+) transport protein 1	60.000%	Swiss-Prot	High
`Q8S3W4`	Arabidopsis thaliana	sp\|Q8S3W4\|ZIP8_ARATH Probable zinc transporter 8	58.400%	Swiss-Prot	High
`O81850`	Arabidopsis thaliana	sp\|O81850\|IRT2_ARATH Fe(2+) transport protein 2	55.000%	Swiss-Prot	High
`Q75HB1`	Oryza sativa subsp. japonica	sp\|Q75HB1\|IRT1_ORYSJ Fe(2+) transport protein 1	58.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card