RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G336990
Reference: TK1151 Chr: Chr05 Coordinates: 83296883-83300279 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2890 bp · TkA05G336990|TK1151|cDNA

TCCCCATAACAATTCCGTGATCGATCGCCTAATCTTGTCCATCATAAGAGTGCATCGTCTTGGCTAATCATAGATCATTAGGAAATGGATTAATTAACAAGGTTCTCCAACCTGTAAATTTTCATCTTGATCATCATTCTATCAATATTAAATTGTATGGAATTGATTGAGAAATCGTTTAATGTGCCCAATAACTCTCAACATCCACAACCATCTCCGGCACAGATCCACCGTGAGTCACCTTCACCGTTCCTCTCCAG...

CDS

Download CDS FASTA

2277 bp · TkA05G336990|TK1151|CDS

ATGTCGATACCTGATGGAGAATTCTCGTCGTCGAATGCCGGCGACCTAGATTTCGGTCAGGAGGTAACGCTTGGTGATAAGCTTAAAGCCTTCAAATCTTCTGGTTTCGATCAGGAAAGTTATGTATCTGCCAAATGCCGCACAACAAGCGAAAAGGAAATAAAGCACTTGGTGACTTGTCTTCTAGATCTCAAGAAGGCGTCGGCAGAAGAAATGCGAAAAAGTGTGTACGCTAATTACCCTTCCTTTATCCGCGTATC...

Protein

Download Protein FASTA

758 aa · TkA05G336990|TK1151|PROTEIN

MSIPDGEFSSSNAGDLDFGQEVTLGDKLKAFKSSGFDQESYVSAKCRTTSEKEIKHLVTCLLDLKKASAEEMRKSVYANYPSFIRVSREISDLEGQLVALRNLLSNRAAIIHTLAEGTRSESTSSGPGSRKQGSFDLEDREPTKMEVWLSQYIDKLNILLAERRVDEALTALTEGERVAKEEKSNDSMTPEILSSLQDTITEQRQKLADQLAESACQPSSSGTELRSSVEIIKKIGDGPRAHTLLLNSHHQKLQSKIQGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G336990
TK1151 IDTkA05G336990
OH-1004 IDLXL04_020984
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G336990
LocationChr05:83296883-83300279 (+)
DescriptionSimilar to EXO84A: Exocyst complex component EXO84A
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g10385 Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion. No verified direct reference in this release
At5g49830 Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.
The Arabidopsis exocyst complex is involved in cytokinesis and cell plate maturation.2010 · DOI: 10.1105/tpc.110.074351
A Framework for Lateral Membrane Trafficking and Polar Tethering of the PEN3 ATP-Binding Cassette Transporter.2016 · DOI: 10.1104/pp.16.01252
At1g10180 Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_020984 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006887 exocytosis Biological Process
GO:0006893 Golgi to plasma membrane transport Biological Process
GO:0008104 intracellular protein localization Biological Process
GO:0015031 protein transport Biological Process
GO:0060321 acceptance of pollen Biological Process
GO:0000145 exocyst Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005776 autophagosome Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G10180
ath:AT1G10385
ath:AT5G49830
cnb:CNBH1990
ddi:DDB_G0279991
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.583
Rank 1 · TkA05G336990 · TK1151
Golgi apparatus0.250
Rank 2 · TkA05G336990 · TK1151
Cell membrane0.196
Rank 3 · TkA05G336990 · TK1151
Nucleus0.189
Rank 4 · TkA05G336990 · TK1151
Lysosome / Vacuole0.174
Rank 5 · TkA05G336990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17175MOLO121-69 aa
PF06148COG2_N30-100 aa
PF08700VPS51_Exo84_N31-106 aa
PF16528Exo84_C90-114 aa
PF16528Exo84_C148-356 aa
PF16752TBCC_N178-261 aa
PF08700VPS51_Exo84_N192-209 aa
PF17175MOLO1193-258 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G336990PF17175MOLO121690.7210.8
TkA05G336990PF06148COG2_N301000.000222.1
TkA05G336990PF08700VPS51_Exo84_N311064.7e-1143.3
TkA05G336990PF16528Exo84_C901143e-2073.6
TkA05G336990PF16528Exo84_C1483563e-2073.6
TkA05G336990PF16752TBCC_N1782610.1413.2
TkA05G336990PF08700VPS51_Exo84_N1922094.7e-1143.3
TkA05G336990PF17175MOLO11932580.7210.8
TkA05G336990PF08700VPS51_Exo84_N2482624.7e-1143.3
TkA05G336990PF27696EXO84_helical3905597e-53179.6
TkA05G336990PF17175MOLO15335620.7210.8
TkA05G336990PF06148COG2_N5435570.000222.1
TkA05G336990PF029497tm_65586190.1811.5
TkA05G336990PF07759DUF16156777420.1811.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4I4B6Arabidopsis thalianasp|F4I4B6|EX84A_ARATH Exocyst complex component EXO84A57.300%Swiss-ProtHigh
Q9LTB0Arabidopsis thalianasp|Q9LTB0|EX84B_ARATH Exocyst complex component EXO84B56.300%Swiss-ProtHigh
Q9SY60Arabidopsis thalianasp|Q9SY60|EX84C_ARATH Exocyst complex component EXO84C32.400%Swiss-ProtMedium

JBrowse

View in Genome Browser