TkA05G331410 | RubberDandelionOmics

Gene overview

TkA05G331410

Reference: TK1151 Chr: Chr05 Coordinates: 81619780-81620100 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

321 bp · TkA05G331410|TK1151|cDNA

TGCATCTGCGTCGTCCCTTCCGTCCTTCTGCCGCTGCGAACGTTCTACACCCCGCGATCTAAAACCCAGCACTTGCTCGTCGATTCCAATTGCGACCTAAAAATCTGTGATTTCGGGCTTGCGAGAACAACATCCGAGACGGATTTCATGACCGAATACGTCGTCACCAGGTGGTACAGAAGAGAGATGGAGAAGAGAGATGTGCTCTGGTTGAAGCAACGGGTGAAGCACACGGCGGAGAGCGTACCATCTCTCCCGGT...

CDS

Download CDS FASTA

321 bp · TkA05G331410|TK1151|CDS

TGCATCTGCGTCGTCCCTTCCGTCCTTCTGCCGCTGCGAACGTTCTACACCCCGCGATCTAAAACCCAGCACTTGCTCGTCGATTCCAATTGCGACCTAAAAATCTGTGATTTCGGGCTTGCGAGAACAACATCCGAGACGGATTTCATGACCGAATACGTCGTCACCAGGTGGTACAGAAGAGAGATGGAGAAGAGAGATGTGCTCTGGTTGAAGCAACGGGTGAAGCACACGGCGGAGAGCGTACCATCTCTCCCGGT...

Protein

Download Protein FASTA

106 aa · TkA05G331410|TK1151|PROTEIN

CICVVPSVLLPLRTFYTPRSKTQHLLVDSNCDLKICDFGLARTTSETDFMTEYVVTRWYRREMEKRDVLWLKQRVKHTAESVPSLPVGLDAVLIGGEGGRNCVKGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G331410`
TK1151 ID	TkA05G331410
OH-1004 ID	LXL04_036492
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 37.736 / OH-1004 10.695 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G331410

Location Chr05:81619780-81620100 (+)

Description Similar to NTF6: Mitogen-activated protein kinase homolog NTF6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0154500`	Involved in sphingolipid elicitor (SE)-dependent defense signaling pathway.	A sphingolipid elicitor-inducible mitogen-activated protein kinase is regulated by the small GTPase OsRac1 and heterotrimeric G-protein in rice 1[w].2005 · DOI: 10.1104/pp.104.057414 OsDMI3-mediated activation of OsMPK1 regulates the activities of antioxidant enzymes in abscisic acid signalling in rice.2014 · DOI: 10.1111/pce.12154

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036492 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0010225 response to UV-C Biological Process

GO:0010311 lateral root formation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004707 MAP kinase activity Molecular Function

GO:0004713 protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G07880

dosa:Os08g0157000

dosa:Os10g0533600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.492

Rank 1 · TkA05G331410 · TK1151

Nucleus0.416

Rank 2 · TkA05G331410 · TK1151

Mitochondrion0.131

Rank 3 · TkA05G331410 · TK1151

Cell membrane0.070

Rank 4 · TkA05G331410 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA05G331410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase21-60 aa

PF07714PK_Tyr_Ser-Thr23-62 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G331410	`PF00069`	Pkinase	21	60	3.4e-07	30.6
TkA05G331410	`PF07714`	PK_Tyr_Ser-Thr	23	62	0.0056	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84UI5`	Oryza sativa subsp. japonica	sp\|Q84UI5\|MPK1_ORYSJ Mitogen-activated protein kinase 1	85.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card