TkA05G327690 | RubberDandelionOmics

Gene overview

TkA05G327690

Reference: TK1151 Chr: Chr05 Coordinates: 80692752-80696773 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

861 bp · TkA05G327690|TK1151|cDNA

ATGCTTCTTAGCATTCGTGTAGAGGCGGAGCTTGTGGAGGAGCGTACGGTGGACCACTGCACTACTTCTTCTCAGCCGAGACGTTCGGACCGAGAGACTGCCCAAAAGCGGCCGAGAAGGCGAACAGACGCATATTCGCCATGGGAACTGAGGAAGACTAGTAGACCCGCGTTACGTGACGGGATCCTAAGCATTGGAATTGGGACTTACAATTGGTATCAGAGTTTAAAAAAACAAGCAATCTCCAAGAACAATAAGAA...

CDS

Download CDS FASTA

861 bp · TkA05G327690|TK1151|CDS

ATGCTTCTTAGCATTCGTGTAGAGGCGGAGCTTGTGGAGGAGCGTACGGTGGACCACTGCACTACTTCTTCTCAGCCGAGACGTTCGGACCGAGAGACTGCCCAAAAGCGGCCGAGAAGGCGAACAGACGCATATTCGCCATGGGAACTGAGGAAGACTAGTAGACCCGCGTTACGTGACGGGATCCTAAGCATTGGAATTGGGACTTACAATTGGTATCAGAGTTTAAAAAAACAAGCAATCTCCAAGAACAATAAGAA...

Protein

Download Protein FASTA

286 aa · TkA05G327690|TK1151|PROTEIN

MLLSIRVEAELVEERTVDHCTTSSQPRRSDRETAQKRPRRRTDAYSPWELRKTSRPALRDGILSIGIGTYNWYQSLKKQAISKNNKNRHLNSKLRSYFSKKRFLFSSPGSLPSPTRTTVSFLGRDQFSDQPSATNLPRQLVRVLHEPDQIFRVLCLFVVAVSDGLKAWEVLKGKSQHIDLILTEVELPSISGFALLTLITEHQVCKNIPVIMTAVLIAEFDYVVTFLVSGKLVKGLGSCECENGWEFYDMKNLIGEASCR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G327690`
TK1151 ID	TkA05G327690
OH-1004 ID	LXL04_023082
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	52.900
Protein coverage (%)	TK1151 47.203 / OH-1004 12.884 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G327690

Location Chr05:80692752-80696773 (+)

Description Similar to Os03g0733400: Zinc finger BED domain-containing protein RICESLEEPER 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46790`	Transcriptional repressor of CCA1 and LHY, and positive regulator of LWD1 and LWD2 expression.	Circadian waves of expression of the APRR1/TOC1 family of pseudo-response regulators in Arabidopsis thaliana: insight into the plant circadian clock.2000 · DOI: 10.1093/pcp/pcd043
`At5g24470`	Transcriptional repressor of CCA1 and LHY, thereby controlling photoperiodic flowering response.	Circadian waves of expression of the APRR1/TOC1 family of pseudo-response regulators in Arabidopsis thaliana: insight into the plant circadian clock.2000 · DOI: 10.1093/pcp/pcd043

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0532400`	Controls photoperiodic flowering response.	No verified direct reference in this release
`UniProt: A2XFB7`	Controls photoperiodic flowering response.	No verified direct reference in this release
`Os03g0284100`	Controls photoperiodic flowering response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023082 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

dosa:Os03g0733400

dosa:Os05g0239150

dosa:Os05g0583200

osa:4339741

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.488

Rank 1 · TkA05G327690 · TK1151

Cytoplasm0.389

Rank 2 · TkA05G327690 · TK1151

Cell membrane0.092

Rank 3 · TkA05G327690 · TK1151

Mitochondrion0.079

Rank 4 · TkA05G327690 · TK1151

Endoplasmic reticulum0.078

Rank 5 · TkA05G327690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17703C19orf8416-58 aa

PF07071KDGP_aldolase60-95 aa

PF00072Response_reg157-215 aa

PF05129Zn_ribbon_Elf1249-271 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G327690	`PF17703`	C19orf84	16	58	0.28	11.6
TkA05G327690	`PF07071`	KDGP_aldolase	60	95	0.23	12.0
TkA05G327690	`PF00072`	Response_reg	157	215	2.2e-07	31.8
TkA05G327690	`PF05129`	Zn_ribbon_Elf1	249	271	0.021	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L500`	Arabidopsis thaliana	sp\|Q8L500\|APRR9_ARATH Two-component response regulator-like APRR9	61.600%	Swiss-Prot	Low
`Q6LA42`	Arabidopsis thaliana	sp\|Q6LA42\|APRR5_ARATH Two-component response regulator-like APRR5	56.500%	Swiss-Prot	Low
`Q689G6`	Oryza sativa subsp. japonica	sp\|Q689G6\|PRR95_ORYSJ Two-component response regulator-like PRR95	43.800%	Swiss-Prot	Low
`A2XFB7`	Oryza sativa subsp. indica	sp\|A2XFB7\|PRR73_ORYSI Two-component response regulator-like PRR73	49.200%	Swiss-Prot	Low
`Q10N34`	Oryza sativa subsp. japonica	sp\|Q10N34\|PRR73_ORYSJ Two-component response regulator-like PRR73	49.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card