TkA05G316490 | RubberDandelionOmics

Gene overview

TkA05G316490

Reference: TK1151 Chr: Chr05 Coordinates: 78110803-78117373 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2742 bp · TkA05G316490|TK1151|cDNA

ATGCGACGTCTTGGACGAACCATGGCCGACGTCAGAGGAGAACCGTGGCCGGCGTTGGAGAGGAGGTCCATCCTCGGACCATGGGAACCACTGGCGATCGGAGGCGATGACGGGACGTCGACGATGATGGGATGCCGACAATGGTGGGACGCCGACGATGGTGGTGGTGAAAGCGGGTTGAGGTTGCTAGCTGACTTGGTTTGTACGTTCCCTTGTTTAGAAGAGACCCAGATCAAGCGTGATTTAATGAATCTATCACA...

CDS

Download CDS FASTA

2742 bp · TkA05G316490|TK1151|CDS

ATGCGACGTCTTGGACGAACCATGGCCGACGTCAGAGGAGAACCGTGGCCGGCGTTGGAGAGGAGGTCCATCCTCGGACCATGGGAACCACTGGCGATCGGAGGCGATGACGGGACGTCGACGATGATGGGATGCCGACAATGGTGGGACGCCGACGATGGTGGTGGTGAAAGCGGGTTGAGGTTGCTAGCTGACTTGGTTTGTACGTTCCCTTGTTTAGAAGAGACCCAGATCAAGCGTGATTTAATGAATCTATCACA...

Protein

Download Protein FASTA

913 aa · TkA05G316490|TK1151|PROTEIN

MRRLGRTMADVRGEPWPALERRSILGPWEPLAIGGDDGTSTMMGCRQWWDADDGGGESGLRLLADLVCTFPCLEETQIKRDLMNLSQGSDTVSTYFTKLKTLWEELSNYNNNCTCGKCTCGGAKEIEQTISFLMGLNSSYAQVRGQILLMDPIPTVNKIFSLIIQEESKPKSGILQDLIRVTRILERILQQWHSLEFFKCYRLHGFPPGYRTNQSQPRANSVDIDQQSSANEETAQPSVTNDVLTGFTQQQCKGLIALLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G316490`
TK1151 ID	TkA05G316490
OH-1004 ID	LXL04_005843
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.300
Protein coverage (%)	TK1151 88.828 / OH-1004 33.476 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G316490

Location Chr05:78110803-78117373 (+)

Description Similar to SBT: Subtilisin-like protease

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release
`At4g02960`	Retrovirus-related Pol polyprotein from transposon RE2.	No verified direct reference in this release
`UniProt: P92520`	Uncharacterized mitochondrial protein AtMg00820.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005843 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0005615 extracellular space Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.531

Rank 1 · TkA05G316490 · TK1151

Nucleus0.453

Rank 2 · TkA05G316490 · TK1151

Mitochondrion0.081

Rank 3 · TkA05G316490 · TK1151

Peroxisome0.051

Rank 4 · TkA05G316490 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA05G316490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30901PEG10-RTL1_C-capsid79-112 aa

PF22936Pol_BBD294-368 aa

PF13976gag_pre-integrs399-464 aa

PF00665rve478-575 aa

PF27444GlnD_3rd515-570 aa

PF25597SH3_retrovirus649-688 aa

PF22936Pol_BBD713-741 aa

PF30901PEG10-RTL1_C-capsid783-803 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G316490	`PF30901`	PEG10-RTL1_C-capsid	79	112	0.009	16.7
TkA05G316490	`PF22936`	Pol_BBD	294	368	2.2e-18	67.1
TkA05G316490	`PF13976`	gag_pre-integrs	399	464	1.8e-13	50.8
TkA05G316490	`PF00665`	rve	478	575	3.1e-11	44.2
TkA05G316490	`PF27444`	GlnD_3rd	515	570	0.21	12.6
TkA05G316490	`PF25597`	SH3_retrovirus	649	688	1.6e-08	34.9
TkA05G316490	`PF22936`	Pol_BBD	713	741	2.2e-18	67.1
TkA05G316490	`PF30901`	PEG10-RTL1_C-capsid	783	803	0.009	16.7
TkA05G316490	`PF07727`	RVT_2	808	886	9.6e-25	88.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94HW2`	Arabidopsis thaliana	sp\|Q94HW2\|POLR1_ARATH Retrovirus-related Pol polyprotein from transposon RE1	27.300%	Swiss-Prot	Low
`Q9ZT94`	Arabidopsis thaliana	sp\|Q9ZT94\|POLR2_ARATH Retrovirus-related Pol polyprotein from transposon RE2	31.100%	Swiss-Prot	Low
`P92520`	Arabidopsis thaliana	sp\|P92520\|M820_ARATH Uncharacterized mitochondrial protein AtMg00820	48.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card