TkA05G315310 | RubberDandelionOmics

Gene overview

TkA05G315310

Reference: TK1151 Chr: Chr05 Coordinates: 77803158-77803778 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

621 bp · TkA05G315310|TK1151|cDNA

ATGAAAGCCATCATGAAACAAATACAGCACCAGCTAGAGCAGAAACAAGAACAAAAAGCGTCGCTACTCAAACAACTAGAAACAGTCAAAGAAGAAGAAGGCCAACTTCAACAAACAATCCAGATATTATCCTCACAAACCACCACAAAGAACGAAGCAGTTAATCCCACTACATCAATACCTAAAGAAGAAGAAATTCAAGAACTTTCATCTGATAGTTCGCAAGAGGAAAAACCCATCTCACAAGAAGAAAAACCGAA...

CDS

Download CDS FASTA

621 bp · TkA05G315310|TK1151|CDS

ATGAAAGCCATCATGAAACAAATACAGCACCAGCTAGAGCAGAAACAAGAACAAAAAGCGTCGCTACTCAAACAACTAGAAACAGTCAAAGAAGAAGAAGGCCAACTTCAACAAACAATCCAGATATTATCCTCACAAACCACCACAAAGAACGAAGCAGTTAATCCCACTACATCAATACCTAAAGAAGAAGAAATTCAAGAACTTTCATCTGATAGTTCGCAAGAGGAAAAACCCATCTCACAAGAAGAAAAACCGAA...

Protein

Download Protein FASTA

206 aa · TkA05G315310|TK1151|PROTEIN

MKAIMKQIQHQLEQKQEQKASLLKQLETVKEEEGQLQQTIQILSSQTTTKNEAVNPTTSIPKEEEIQELSSDSSQEEKPISQEEKPKSTIKTSLIFTPEDFHVIQSSTKEEVKKWYVIFDGSHKVIYNDWGIANSHIIGQNVTHKSYKTKSEAETAYREAYKAVIMDHVIGGCDTRHISVCKSQSNVTVYIYSTFTKKNFNFSLET

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G315310`
TK1151 ID	TkA05G315310
OH-1004 ID	LXL04_038012
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.800
Protein coverage (%)	TK1151 25.243 / OH-1004 8.293 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G315310`
Location	Chr05:77803158-77803778 (+)
Description	Similar to G9: Polygalacturonase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038012` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0009555 pollen development Biological Process GO:0009846 pollen germination Biological Process GO:0045490 pectin catabolic process Biological Process GO:0048868 pollen tube development Biological Process GO:0071555 cell wall organization Biological Process GO:0005576 extracellular region Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0031982 vesicle Cellular Component GO:0043667 pollen wall Cellular Component GO:0004650 polygalacturonase activity Molecular Function
KEGG gene cross-reference	ath:AT3G07850 ghi:107942091 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.528

Rank 1 · TkA05G315310 · TK1151

Nucleus0.513

Rank 2 · TkA05G315310 · TK1151

Mitochondrion0.064

Rank 3 · TkA05G315310 · TK1151

Cell membrane0.038

Rank 4 · TkA05G315310 · TK1151

Endoplasmic reticulum0.028

Rank 5 · TkA05G315310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24181TPR_TTI1_C2-91 aa

PF15794CCDC1064-85 aa

PF05549Allexi_40kDa6-91 aa

PF05285SDA1_dom35-114 aa

PF01693Cauli_VI114-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G315310	`PF24181`	TPR_TTI1_C	2	91	6.8	7.0
TkA05G315310	`PF15794`	CCDC106	4	85	0.68	10.4
TkA05G315310	`PF05549`	Allexi_40kDa	6	91	1.2	9.3
TkA05G315310	`PF05285`	SDA1_dom	35	114	0.069	14.4
TkA05G315310	`PF01693`	Cauli_VI	114	156	3.2e-06	28.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card