TkA05G314690 | RubberDandelionOmics

Gene overview

TkA05G314690

Reference: TK1151 Chr: Chr05 Coordinates: 77651698-77654073 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2067 bp · TkA05G314690|TK1151|cDNA

ATGGTGAGAGGAAGGCTCACACTCCTTCCCAAGCTTACAACACTTTCTTCCCCCTCTCCAATCTCGAACGCTAAATTCCTCTCTTCCAACTCCAAAAACAATGGTACTGTAGAATCTAATGATCCACAGGAACAGCTCGGAAAGCTTCACGCACTACTGCACCAAGGTCAAACCCAAACAGCCAAAAATCTAATCAAATCCCTCATAACTTCCAAGTCCATCTTCACTACACCTTCTGATATATACACTCGGTATACGGA...

CDS

Download CDS FASTA

2067 bp · TkA05G314690|TK1151|CDS

ATGGTGAGAGGAAGGCTCACACTCCTTCCCAAGCTTACAACACTTTCTTCCCCCTCTCCAATCTCGAACGCTAAATTCCTCTCTTCCAACTCCAAAAACAATGGTACTGTAGAATCTAATGATCCACAGGAACAGCTCGGAAAGCTTCACGCACTACTGCACCAAGGTCAAACCCAAACAGCCAAAAATCTAATCAAATCCCTCATAACTTCCAAGTCCATCTTCACTACACCTTCTGATATATACACTCGGTATACGGA...

Protein

Download Protein FASTA

688 aa · TkA05G314690|TK1151|PROTEIN

MVRGRLTLLPKLTTLSSPSPISNAKFLSSNSKNNGTVESNDPQEQLGKLHALLHQGQTQTAKNLIKSLITSKSIFTTPSDIYTRYTEKPKLFSSLILSVCAEANFPNEAIDLYALIRKDGIFPSLASFNLLLECLVSSGQYSKVLELFDQFISSGIRVDKFTYGKAVQSAVKMGDLRLGMELMDCMKNTGRMNVSTFVYNVLIGGLCKQKRLMDARKLFDEMLERDVAPDKVTYNTMIDGYCKVGNLEEAYRICEEMKAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G314690`
TK1151 ID	TkA05G314690
OH-1004 ID	LXL04_022839
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	24.100
Protein coverage (%)	TK1151 19.622 / OH-1004 32.381 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G314690

Location Chr05:77651698-77654073 (-)

Description Similar to At2g13420: Pentatricopeptide repeat-containing protein At2g13420, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18750`	Plays a major role in single RNA editing events in chloroplasts.	Identification of two pentatricopeptide repeat genes required for RNA editing and zinc binding by C-terminal cytidine deaminase-like domains.2013 · DOI: 10.1074/jbc.m113.485755

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022839 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G20300

ath:AT1G52640

ath:AT1G71060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.845

Rank 1 · TkA05G314690 · TK1151

Plastid0.089

Rank 2 · TkA05G314690 · TK1151

Nucleus0.053

Rank 3 · TkA05G314690 · TK1151

Cytoplasm0.038

Rank 4 · TkA05G314690 · TK1151

Cell membrane0.012

Rank 5 · TkA05G314690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25062ARM_TT21_N37-76 aa

PF24760TPR_IF140_C40-59 aa

PF13428TPR_1443-69 aa

PF13041PPR_249-66 aa

PF29834SOV1_C49-68 aa

PF18954DUF569749-98 aa

PF27195YdhT_N50-66 aa

PF14559TPR_1951-68 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G314690	`PF25062`	ARM_TT21_N	37	76	0.067	13.6
TkA05G314690	`PF24760`	TPR_IF140_C	40	59	3e-08	34.8
TkA05G314690	`PF13428`	TPR_14	43	69	1.9e-05	25.6
TkA05G314690	`PF13041`	PPR_2	49	66	2.7e-161	524.4
TkA05G314690	`PF29834`	SOV1_C	49	68	0.1	12.3
TkA05G314690	`PF18954`	DUF5697	49	98	0.18	12.6
TkA05G314690	`PF27195`	YdhT_N	50	66	0.15	12.4
TkA05G314690	`PF14559`	TPR_19	51	68	0.0011	20.0
TkA05G314690	`PF26719`	TPR_Atp25_C	88	178	0.057	13.3
TkA05G314690	`PF17177`	PPR_long	92	163	4.9e-49	167.3
TkA05G314690	`PF13041`	PPR_2	96	135	2.7e-161	524.4
TkA05G314690	`PF01535`	PPR	96	121	3.4e-119	381.8
TkA05G314690	`PF13812`	PPR_3	96	135	5.1e-73	241.8
TkA05G314690	`PF23276`	TPR_24	96	221	1.4e-36	126.0
TkA05G314690	`PF29070`	MSC6_N	102	174	2.1e-33	116.7
TkA05G314690	`PF08579`	RPM2	107	136	7e-06	27.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SN39`	Arabidopsis thaliana	sp\|Q9SN39\|PP320_ARATH Pentatricopeptide repeat-containing protein DOT4, chloroplastic	33.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card