TkA05G311880 | RubberDandelionOmics

Gene overview

TkA05G311880

Reference: TK1151 Chr: Chr05 Coordinates: 76960224-76967376 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2549 bp · TkA05G311880|TK1151|cDNA

TTATAAAAAGAAAATTGGACGAAAAACTCTTTGCATTAATGTGGTTGCCATCTAACAGTACTATGATAAAAGCTATTGAGACGCGTGGTGACAACTGACAGAATGAAACTAAGCGACGTCAATGTCCTCCACCGACGACAGTGACACCTGCCGGAGAAGTTAAAACTACGCTCTCACCGCCGGACAAAAAGTGACGAAAATGTCTTCTAGATTTCCTAAAACAATCTTATGCCGATAAATCCTCCAACCCCTTTGCGATG...

CDS

Download CDS FASTA

1896 bp · TkA05G311880|TK1151|CDS

ATGAACAAGCTTATCTTCTTTATCTTCATCTTCTTAGTTTTTTCCTCTGAAAGGGTCTTATCTGAGATCCATGCTAGCTTACCACCAAGAGGTTGGAATTCATACGATTCCTTTTGTTGGACAATCTCGGAAGACGAATTTATTCAAAATGCTCAACTTATTTCACAGAAGTTGCATGCTCATGGCTATGAGTATGCGGTTGTGGATTACCTTTGGTATAGAAAGTTAGTTCCCGGTGCTTATGTTGATTCACTTGGGTA...

Protein

Download Protein FASTA

631 aa · TkA05G311880|TK1151|PROTEIN

MNKLIFFIFIFLVFSSERVLSEIHASLPPRGWNSYDSFCWTISEDEFIQNAQLISQKLHAHGYEYAVVDYLWYRKLVPGAYVDSLGYDVIDEWGRVIPDPHRWPSSKGGKGFKEVAKKVHDMGLKFGFHIMRGISTQAVNANTPILDITTGKAYTEGGKVWHAKDIGLKERACGWMKNGFMSVDTTKGAGRAFLKSLHHQYADWDVDFLKHDCVFGDDFELSEITLVSEILEGLNRPILYSLSPGTSATPVMAQQVATLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G311880`
TK1151 ID	TkA05G311880
OH-1004 ID	LXL04_012767
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	26.800
Protein coverage (%)	TK1151 31.379 / OH-1004 45.636 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G311880`
Location	Chr05:76960224-76967376 (-)
Description	Similar to Alpha-galactosidase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012767` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0009620 response to fungus Biological Process GO:0009911 positive regulation of flower development Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0051682 galactomannan catabolic process Biological Process GO:0071555 cell wall organization Biological Process GO:0009505 plant-type cell wall Cellular Component GO:0048046 apoplast Cellular Component GO:0099503 secretory vesicle Cellular Component GO:0004557 alpha-galactosidase activity Molecular Function GO:0052692 raffinose alpha-galactosidase activity Molecular Function
KEGG gene cross-reference	ath:AT5G08370 ath:AT5G08380 dosa:Os10g0493600 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.382

Rank 1 · TkA05G311880 · TK1151

Extracellular0.209

Rank 2 · TkA05G311880 · TK1151

Endoplasmic reticulum0.148

Rank 3 · TkA05G311880 · TK1151

Cytoplasm0.145

Rank 4 · TkA05G311880 · TK1151

Golgi apparatus0.107

Rank 5 · TkA05G311880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16499Melibiase_241-136 aa

PF16499Melibiase_2199-373 aa

PF00652Ricin_B_lectin452-543 aa

PF17801Melibiase_C549-628 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G311880	`PF16499`	Melibiase_2	41	136	4e-19	69.7
TkA05G311880	`PF16499`	Melibiase_2	199	373	4e-19	69.7
TkA05G311880	`PF00652`	Ricin_B_lectin	452	543	3.2e-05	24.8
TkA05G311880	`PF17801`	Melibiase_C	549	628	7.5e-09	36.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card