TkA05G306870 | RubberDandelionOmics

Gene overview

TkA05G306870

Reference: TK1151 Chr: Chr05 Coordinates: 75753265-75762037 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · TkA05G306870|TK1151|cDNA

ATGCTCACCGCAGACTCTCAATCCGCGGCTAATCACACACAAAATCAGTTAGGGGGTGCATTAGATATGATCCACGCAGAGCTTCTCCCTCAAGATAAAGCCAAAATCATCAAACAATTCCAAACGGAATCCCCAACCGCCATGGTCGGAGACGGGCTCAATGACGCCCCTGCTCTAGCAACCGCCGACATCGGAATCTCAATGGGGGTTTCCGGATCTGCGTTGGCAAACGAAACCGGACACATGATTTTAATGTCCAA...

CDS

Download CDS FASTA

1176 bp · TkA05G306870|TK1151|CDS

ATGCTCACCGCAGACTCTCAATCCGCGGCTAATCACACACAAAATCAGTTAGGGGGTGCATTAGATATGATCCACGCAGAGCTTCTCCCTCAAGATAAAGCCAAAATCATCAAACAATTCCAAACGGAATCCCCAACCGCCATGGTCGGAGACGGGCTCAATGACGCCCCTGCTCTAGCAACCGCCGACATCGGAATCTCAATGGGGGTTTCCGGATCTGCGTTGGCAAACGAAACCGGACACATGATTTTAATGTCCAA...

Protein

Download Protein FASTA

391 aa · TkA05G306870|TK1151|PROTEIN

MLTADSQSAANHTQNQLGGALDMIHAELLPQDKAKIIKQFQTESPTAMVGDGLNDAPALATADIGISMGVSGSALANETGHMILMSNDIRKIPISVRLARKTRRKIFKNIFIAIITKAAIIALAIAGHPLVWAAVLADVGTCLLVIFNSTLETDSLLLVLNYIYPVPAVQVSGTAVSDTKGPRCQVTIVYSVATTSIVHHEITSIPVTPTVPIPTSTETSQPQTTQIPLTKPLSPPHVTFVTTTTTEIPPETQKPEQPRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G306870`
TK1151 ID	TkA05G306870
OH-1004 ID	LXL04_038771
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.600
Protein coverage (%)	TK1151 42.455 / OH-1004 91.713 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G306870

Location Chr05:75753265-75762037 (-)

Description Similar to HMA4: Putative cadmium/zinc-transporting ATPase HMA4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19110`	Involved in cadmium/zinc transport.	No verified direct reference in this release
`At4g30110`	Plays an important role in zinc transport and homeostasis.	P-type ATPase heavy metal transporters with roles in essential zinc homeostasis in Arabidopsis.2004 · DOI: 10.1105/tpc.020487
`UniProt: P0CW78`	In a heterologous system, involved in cadmium and lead transport, but not in zinc transport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0700700`	Zinc/cadmium transporter that plays an essential role in promoting translocation of zinc and cadmium from roots to shoots.	Cadmium retention in rice roots is influenced by cadmium availability, chelation and translocation.2011 · DOI: 10.1111/j.1365-3040.2011.02299.x Mutations in rice (Oryza sativa) heavy metal ATPase 2 (OsHMA2) restrict the translocation of zinc and cadmium.2012 · DOI: 10.1093/pcp/pcr166 The OsHMA2 transporter is involved in root-to-shoot translocation of Zn and Cd in rice.2012 · DOI: 10.1111/j.1365-3040.2012.02527.x Preferential delivery of zinc to developing tissues in rice is mediated by P-type heavy metal ATPase OsHMA2.2013 · DOI: 10.1104/pp.113.216564
`Os07g0232900`	Root-specific cadmium (Cd) transporter that mediates Cd efflux in root vacuoles.	Gene limiting cadmium accumulation in rice.2010 · DOI: 10.1073/pnas.1005396107 OsHMA3, a P1B-type of ATPase affects root-to-shoot cadmium translocation in rice by mediating efflux into vacuoles.2011 · DOI: 10.1111/j.1469-8137.2010.03459.x Overexpression of OsHMA3 enhances Cd tolerance and expression of Zn transporter genes in rice.2014 · DOI: 10.1093/jxb/eru340

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038771 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006829 zinc ion transport Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0015691 cadmium ion transport Biological Process

GO:0030001 metal ion transport Biological Process

GO:0032025 response to cobalt ion Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0071585 detoxification of cadmium ion Biological Process

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G19110

ath:AT4G30110

dosa:Os06g0700650

dosa:Os07g0232900

osa:4342783

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.446

Rank 1 · TkA05G306870 · TK1151

Nucleus0.299

Rank 2 · TkA05G306870 · TK1151

Endoplasmic reticulum0.176

Rank 3 · TkA05G306870 · TK1151

Mitochondrion0.118

Rank 4 · TkA05G306870 · TK1151

Cell membrane0.105

Rank 5 · TkA05G306870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00702Hydrolase1-63 aa

PF08282Hydrolase_344-83 aa

PF08282Hydrolase_3317-386 aa

PF27670DCAF1_N319-369 aa

PF27400TP_0700320-368 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G306870	`PF00702`	Hydrolase	1	63	6.8e-09	37.1
TkA05G306870	`PF08282`	Hydrolase_3	44	83	0.088	13.2
TkA05G306870	`PF08282`	Hydrolase_3	317	386	0.088	13.2
TkA05G306870	`PF27670`	DCAF1_N	319	369	0.17	12.8
TkA05G306870	`PF27400`	TP_0700	320	368	0.088	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64474`	Arabidopsis thaliana	sp\|O64474\|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4	69.500%	Swiss-Prot	Low
`Q9SZW4`	Arabidopsis thaliana	sp\|Q9SZW4\|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2	69.700%	Swiss-Prot	Low
`P0CW78`	Arabidopsis thaliana	sp\|P0CW78\|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA3	65.800%	Swiss-Prot	Low
`A3BF39`	Oryza sativa subsp. japonica	sp\|A3BF39\|HMA2_ORYSJ Cadmium/zinc-transporting ATPase HMA2	64.200%	Swiss-Prot	Low
`Q8H384`	Oryza sativa subsp. japonica	sp\|Q8H384\|HMA3_ORYSJ Cadmium/zinc-transporting ATPase HMA3	56.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card