TkA05G279400 | RubberDandelionOmics

Gene overview

TkA05G279400

Reference: TK1151 Chr: Chr05 Coordinates: 69057957-69066397 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · TkA05G279400|TK1151|cDNA

TTGAACCTCCCTTTTGGTGGGAAGATAATGATATTGGGAGGTGATTTTAAACAATTCCAAAGATGGTTCACTTATTTAAACTTTGATTTCAAAAAAGGAGGGTGGTCACATGAAGATGATATGCTTTTATGTGAGGCCCAAAAGATATTTGGCAACAGATGGACTGAAATTGCAAAATGTATAACTTCTTTAAATTTGAAGTTTTGTGCCTTCACTACAAAGGCTAAAATCCGAGTGGTAGCTTGGGAACATACGGTATC...

CDS

Download CDS FASTA

429 bp · TkA05G279400|TK1151|CDS

TTGAACCTCCCTTTTGGTGGGAAGATAATGATATTGGGAGGTGATTTTAAACAATTCCAAAGATGGTTCACTTATTTAAACTTTGATTTCAAAAAAGGAGGGTGGTCACATGAAGATGATATGCTTTTATGTGAGGCCCAAAAGATATTTGGCAACAGATGGACTGAAATTGCAAAATGTATAACTTCTTTAAATTTGAAGTTTTGTGCCTTCACTACAAAGGCTAAAATCCGAGTGGTAGCTTGGGAACATACGGTATC...

Protein

Download Protein FASTA

142 aa · TkA05G279400|TK1151|PROTEIN

LNLPFGGKIMILGGDFKQFQRWFTYLNFDFKKGGWSHEDDMLLCEAQKIFGNRWTEIAKCITSLNLKFCAFTTKAKIRVVAWEHTVSATIMIPMSMWELLLSFVLKEEANDYIIHLSTLYSQRAFVKYHLPLRKLLLTFTMN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G279400`
TK1151 ID	TkA05G279400
OH-1004 ID	LXL04_020642
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 85.915 / OH-1004 99.187 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G279400

Location Chr05:69057957-69066397 (-)

Description Similar to MYB124: Transcription factor MYB124

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14350`	Transcription factor that binds to DNA in promoters cis- regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre- replication complex.	Developmental regulation of CYCA2s contributes to tissue-specific proliferation in Arabidopsis.2011 · DOI: 10.1038/emboj.2011.240
`At2g02820`	Transcription factor that binds to DNA in promoters cis- regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre- replication complex.	The Arabidopsis R2R3 MYB proteins FOUR LIPS and MYB88 restrict divisions late in the stomatal cell lineage.2005 · DOI: 10.1105/tpc.105.034116 Regulation of cell proliferation in the stomatal lineage by the Arabidopsis MYB FOUR LIPS via direct targeting of core cell cycle genes.2010 · DOI: 10.1105/tpc.110.074609 Role of the stomatal development regulators FLP/MYB88 in abiotic stress responses.2010 · DOI: 10.1111/j.1365-313x.2010.04364.x Developmental regulation of CYCA2s contributes to tissue-specific proliferation in Arabidopsis.2011 · DOI: 10.1038/emboj.2011.240 FOUR LIPS and MYB88 conditionally restrict the G1/S transition during stomatal formation.2013 · DOI: 10.1093/jxb/ert313 Deep functional redundancy between FAMA and FOUR LIPS in stomatal development.2014 · DOI: 10.1111/tpj.12489 Requirement for A-type cyclin-dependent kinase and cyclins for the terminal division in the stomatal lineage of Arabidopsis.2014 · DOI: 10.1093/jxb/eru139 Transcriptional regulation of PIN genes by FOUR LIPS and MYB88 during Arabidopsis root gravitropism.2015 · DOI: 10.1038/ncomms9822

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020642 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009554 megasporogenesis Biological Process

GO:0009629 response to gravity Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010052 guard cell differentiation Biological Process

GO:0010235 guard mother cell cytokinesis Biological Process

KEGG gene cross-reference

ath:AT1G14350

ath:AT2G02820

hsa:4605

mmu:17865

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.327

Rank 1 · TkA05G279400 · TK1151

Nucleus0.246

Rank 2 · TkA05G279400 · TK1151

Mitochondrion0.236

Rank 3 · TkA05G279400 · TK1151

Extracellular0.105

Rank 4 · TkA05G279400 · TK1151

Peroxisome0.052

Rank 5 · TkA05G279400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05970PIF13-19 aa

PF13921Myb_DNA-bind_619-32 aa

PF00249Myb_DNA-binding20-26 aa

PF00249Myb_DNA-binding32-62 aa

PF13921Myb_DNA-bind_635-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G279400	`PF05970`	PIF1	3	19	0.013	15.8
TkA05G279400	`PF13921`	Myb_DNA-bind_6	19	32	8.4e-05	23.4
TkA05G279400	`PF00249`	Myb_DNA-binding	20	26	4.7e-06	27.4
TkA05G279400	`PF00249`	Myb_DNA-binding	32	62	4.7e-06	27.4
TkA05G279400	`PF13921`	Myb_DNA-bind_6	35	82	8.4e-05	23.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94FL6`	Arabidopsis thaliana	sp\|Q94FL6\|MY124_ARATH Transcription factor MYB124	74.400%	Swiss-Prot	Low
`F4IRB4`	Arabidopsis thaliana	sp\|F4IRB4\|MYB88_ARATH Transcription factor MYB88	72.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card