TkA05G277790 | RubberDandelionOmics

Gene overview

TkA05G277790

Reference: TK1151 Chr: Chr05 Coordinates: 68663708-68675329 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1982 bp · TkA05G277790|TK1151|cDNA

CAAGAAAACAAAATAAAATAGTATAGGCTACCACCATGGATCAACCCTAATTTATTCAGTCCCTCGCTTTTGGTGGTCTGACTTCCTTCTGATTGGATTCGTAGCTTAATACAGAGCTTCAATAGAAAAATGAGGTCTTCGATCAAACGTCCGCCTACTCCAGACGCAGAGGAGGAAGAACATGATCGAGAACCTACTCTTCAAGAAATCATAAACATCAAATTGATTGAGAGTGGCGAGAAAGAACGATTGAAGGAGCT...

CDS

Download CDS FASTA

1122 bp · TkA05G277790|TK1151|CDS

ATGCAAACTAAAAAAGTAGCAATGGGTAGAAATTCATCTAAAGCACTCGCAAGTCCAAAAGTTTCAAAAACTCAAAAGAAGGTTCCGGAAGACAAGAAAGCCTCTCAAATGATCACCTCTTCCGCTAGAAAACAAAAACCAGCCACAATTAGAAATGACATCAAGGAGAATGTTGAAGCAACCAATTTAAACACCACAAATATATGTTTGGATAATGATTCCGAGGATCGCGATGAAAACGGAACCATATTCTCTCCTAC...

Protein

Download Protein FASTA

373 aa · TkA05G277790|TK1151|PROTEIN

MQTKKVAMGRNSSKALASPKVSKTQKKVPEDKKASQMITSSARKQKPATIRNDIKENVEATNLNTTNICLDNDSEDRDENGTIFSPTFHISRSVEGETVDEEIGCGLSSEVSAIYQCMKDSKLECVDEENHEHDHDVQMEDDECEEYDEFDPYFFIKNLPELASVVPTFRPVLLPKQTRSCPPTTLVLDLDETLVHSTLEACEDADFTFLVNFNMEDHRVYVRCRPYLKEFMERVAGLFEIIIFTASQSIYAEQLLNVLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G277790`
TK1151 ID	TkA05G277790
OH-1004 ID	LXL04_027633
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	58.300
Protein coverage (%)	TK1151 55.228 / OH-1004 45.070 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G277790

Location Chr05:68663708-68675329 (+)

Description Similar to ctdspl2: CTD small phosphatase-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27100`	Component of a deubiquitination module (DUB module) that specifically deubiquitinates monoubiquitinated histone H2B (H2Bub).	The Adaptor Protein ENY2 Is a Component of the Deubiquitination Module of the Arabidopsis SAGA Transcriptional Co-activator Complex but not of the TREX-2 Complex.2018 · DOI: 10.1016/j.jmb.2018.03.018 DET1-mediated degradation of a SAGA-like deubiquitination module controls H2Bub homeostasis.2018 · DOI: 10.7554/elife.37892

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027633 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0045722 positive regulation of gluconeogenesis Biological Process

GO:0046827 positive regulation of protein export from nucleus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity Molecular Function

KEGG gene cross-reference

ddi:DDB_G0290365

dre:558181

hsa:51496

mmu:329506

rno:311368

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.626

Rank 1 · TkA05G277790 · TK1151

Cytoplasm0.413

Rank 2 · TkA05G277790 · TK1151

Cell membrane0.086

Rank 3 · TkA05G277790 · TK1151

Endoplasmic reticulum0.056

Rank 4 · TkA05G277790 · TK1151

Plastid0.028

Rank 5 · TkA05G277790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04294VanW89-136 aa

PF03031NIF185-345 aa

PF19068DUF5764216-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G277790	`PF04294`	VanW	89	136	0.027	14.7
TkA05G277790	`PF03031`	NIF	185	345	1.6e-59	200.9
TkA05G277790	`PF19068`	DUF5764	216	274	0.15	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQ54`	Arabidopsis thaliana	sp\|Q6NQ54\|ENY2_ARATH Transcription and mRNA export factor ENY2	63.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card