Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1636 bp · TkA05G230310|TK1151|cDNA
GAAATCTTCTCTCAAGTACTGAAATTGTCTCTCAAAATTTTGAAATCCTCTCTTTCAAAATCATTGAAACACGATCTCACTCTTCAACCCGCAGCCAGTTCAACTTGATTTTTGTATTTAGCTTTGCATTTCAGCTTCTTCTTCGTCGATCCCACGAAATCGGAAGCAGCACACAACGGGACTGAGGGCGAGGGCGACTCCGGCGAACCTGCATCGGGACCCGCTTGGCGATCCTGCCGGAGGAGACGACGAGCGACCCC...
1005 bp · TkA05G230310|TK1151|CDS
ATGGCTGGGTTGCTGGGTTGCCGGAGAGGGTGGTTCTTCCTCCTTGTCGGCCACCGCCGAGACCACCATCTAGCCGACGATTTCTTTTCTTCTCCTTCATGGTGCGATAACCTCCAAGCCACAACCGAACATCCAGCAGATTCAAATGAACCGGCACCTATTGACTTGGAGTACTACAGAAAAGGACTTAGATCTCACATAGTTCATTCCTACAAAGATTATTATGACAGTGTTGAAATCCCCAAGTTTGTAGACAAGAC...
Protein
Download Protein FASTA334 aa · TkA05G230310|TK1151|PROTEIN
MAGLLGCRRGWFFLLVGHRRDHHLADDFFSSPSWCDNLQATTEHPADSNEPAPIDLEYYRKGLRSHIVHSYKDYYDSVEIPKFVDKTTPEYKPKFDALMTVTMTADEYFEKHPELKMKFDDEIRNDYWKKLGGLRGYAVGAEGRNVSDARSLKIEGVKDIIAVASGKGGVGKSTTAVNLAVSLANKCQLSVGLLDADLGLLDRSGTILQQRERKIKRVKSRGFSGKSVTGGICGKLLIFWAVGITCCCCQVRGTFGILLP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G230310 |
|---|---|
| TK1151 ID | TkA05G230310 |
| OH-1004 ID | LXL04_023462 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G230310 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:57626629-57631995 (-) | |||||||||
| Description | Similar to At3g52300: ATP synthase subunit d, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0015986 proton motive force-driven ATP synthesis Biological Process GO:0016226 iron-sulfur cluster assembly Biological Process GO:0032543 mitochondrial translation Biological Process GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005730 nucleolus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G52300 ath:AT4G19540 ddi:DDB_G0291193 dme:Dmel_CG3262 hin:HI_1277 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF20720nSTAND324-37 aaPF05873Mt_ATP-synt_D48-90 aaPF05873Mt_ATP-synt_D102-128 aaPF25199nSTAND_NTPase5156-210 aaPF10609ParA157-198 aaPF13614AAA_31159-198 aaPF13481AAA_25159-187 aaPF09140MipZ160-198 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G230310 | PF20720 | nSTAND3 | 24 | 37 | 0.28 | 11.6 |
| TkA05G230310 | PF05873 | Mt_ATP-synt_D | 48 | 90 | 0.004 | 17.7 |
| TkA05G230310 | PF05873 | Mt_ATP-synt_D | 102 | 128 | 0.004 | 17.7 |
| TkA05G230310 | PF25199 | nSTAND_NTPase5 | 156 | 210 | 0.054 | 14.0 |
| TkA05G230310 | PF10609 | ParA | 157 | 198 | 1.4e-13 | 51.6 |
| TkA05G230310 | PF13614 | AAA_31 | 159 | 198 | 1.6e-07 | 32.1 |
| TkA05G230310 | PF13481 | AAA_25 | 159 | 187 | 0.014 | 15.8 |
| TkA05G230310 | PF09140 | MipZ | 160 | 198 | 9.1e-05 | 22.6 |
| TkA05G230310 | PF07015 | VirC1 | 160 | 197 | 0.059 | 13.4 |
| TkA05G230310 | PF01656 | CbiA | 161 | 204 | 5.4e-10 | 40.0 |
| TkA05G230310 | PF02374 | ArsA_ATPase | 163 | 186 | 0.0028 | 17.6 |
| TkA05G230310 | PF20720 | nSTAND3 | 163 | 187 | 0.28 | 11.6 |
| TkA05G230310 | PF00142 | Fer4_NifH | 165 | 188 | 0.014 | 15.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.