TkA05G227760 | RubberDandelionOmics

Gene overview

TkA05G227760

Reference: TK1151 Chr: Chr05 Coordinates: 56976785-56977900 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1116 bp · TkA05G227760|TK1151|cDNA

ATGACAATTTTGTCACCTATTAACAAAACTGTGCAGGAATTAAAACCAGATTACAATAAAGCTTTAGACAAAGAAGCAGAAAGATACTACGTGATCTACAAAGGACCACATGCCGGAATTCATACCGACTGGGGAACTACAGAAACCTTCTGCAAAGTTGACAAAGTCACATGCAGAAAATTCGGCACTGAAGCAAGCGCACGACTAAGCATCGCTCTTTACGAAGAAGCAAGCAAGACAAAAAGACCTCTTCTTAGGCC...

CDS

Download CDS FASTA

1116 bp · TkA05G227760|TK1151|CDS

ATGACAATTTTGTCACCTATTAACAAAACTGTGCAGGAATTAAAACCAGATTACAATAAAGCTTTAGACAAAGAAGCAGAAAGATACTACGTGATCTACAAAGGACCACATGCCGGAATTCATACCGACTGGGGAACTACAGAAACCTTCTGCAAAGTTGACAAAGTCACATGCAGAAAATTCGGCACTGAAGCAAGCGCACGACTAAGCATCGCTCTTTACGAAGAAGCAAGCAAGACAAAAAGACCTCTTCTTAGGCC...

Protein

Download Protein FASTA

371 aa · TkA05G227760|TK1151|PROTEIN

MTILSPINKTVQELKPDYNKALDKEAERYYVIYKGPHAGIHTDWGTTETFCKVDKVTCRKFGTEASARLSIALYEEASKTKRPLLRPKIQTAKEDHRDQRFVIPESIQHEILNQPLEIEEFRHLWNKARAACSEDFVHERFYTTDKKIKSLFNFIEGADPKLIYQAFQAGLIDNIYPSCNLQEIKHFPNSMIEAIKNFRKKVLKAKDDPIYIKVISSIPDWHHDIRFTPYHFLEIGLAKTKKETQISQVMEDKGLPFMEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G227760`
TK1151 ID	TkA05G227760
OH-1004 ID	LXL04_003458
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.500
Protein coverage (%)	TK1151 99.461 / OH-1004 57.026 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G227760`
Location	Chr05:56976785-56977900 (-)
Description	Similar to ORF VI: Transactivator/viroplasmin protein (Figwort mosaic virus (strain DxS)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003458` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0075525 viral translational termination-reinitiation Biological Process GO:0030430 host cell cytoplasm Cellular Component
KEGG gene cross-reference	vg:1489545 vg:940158 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483

Rank 1 · TkA05G227760 · TK1151

Nucleus0.471

Rank 2 · TkA05G227760 · TK1151

Mitochondrion0.094

Rank 3 · TkA05G227760 · TK1151

Cell membrane0.058

Rank 4 · TkA05G227760 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA05G227760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01693Cauli_VI28-68 aa

PF31029Cauli_VI_C117-339 aa

PF08839CDT1172-226 aa

PF26324HopBF1_kinase240-296 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G227760	`PF01693`	Cauli_VI	28	68	0.0048	17.9
TkA05G227760	`PF31029`	Cauli_VI_C	117	339	2.4e-61	207.7
TkA05G227760	`PF08839`	CDT1	172	226	0.014	16.3
TkA05G227760	`PF26324`	HopBF1_kinase	240	296	0.2	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card