TkA05G224020 | RubberDandelionOmics

Gene overview

TkA05G224020

Reference: TK1151 Chr: Chr05 Coordinates: 56111005-56122247 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2076 bp · TkA05G224020|TK1151|cDNA

ATGAGTAATCTTTACGATAAACTTTCAGAAGCCTTTTTCAAAAAAGAATTTGAAAATTCTACAGAATTAATAAAACTCTTATCTCTTGATGACGAATCACGAGAAAAACTCTTTGAAAAGGAACCAAGTAGGTTTAATCAATTTCTAAAAATTGAAGAACCAACCACTGAGTCTGACAATGAAACTGTCAAACCCAAAAGAATGAATCCTATTAAACATGAAAACTTTAATACGTATTCAGATAATGAAAAACCCGAACC...

CDS

Download CDS FASTA

2076 bp · TkA05G224020|TK1151|CDS

ATGAGTAATCTTTACGATAAACTTTCAGAAGCCTTTTTCAAAAAAGAATTTGAAAATTCTACAGAATTAATAAAACTCTTATCTCTTGATGACGAATCACGAGAAAAACTCTTTGAAAAGGAACCAAGTAGGTTTAATCAATTTCTAAAAATTGAAGAACCAACCACTGAGTCTGACAATGAAACTGTCAAACCCAAAAGAATGAATCCTATTAAACATGAAAACTTTAATACGTATTCAGATAATGAAAAACCCGAACC...

Protein

Download Protein FASTA

691 aa · TkA05G224020|TK1151|PROTEIN

MSNLYDKLSEAFFKKEFENSTELIKLLSLDDESREKLFEKEPSRFNQFLKIEEPTTESDNETVKPKRMNPIKHENFNTYSDNEKPEPSHRYRKDNNYEFKMPMHKGIPDTTADKTPIKIGILNLDCITDMQVKEEMIKRWVTEISLIIQTNEDDFTTAKKVLLLIEHKTSGNVQNFIKNMTWEDVALALEPVDFLDAINSLLYTFFLDTGASLCIANSYIIPDVFWENSPRTINVTIADGNNLQLNKVCRNISIELAGEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G224020`
TK1151 ID	TkA05G224020
OH-1004 ID	LXL04_020526
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.300
Protein coverage (%)	TK1151 43.271 / OH-1004 37.594 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G224020`
Location	Chr05:56111005-56122247 (+)
Description	Similar to ORF V: Enzymatic polyprotein (Figwort mosaic virus (strain DxS)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020526` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function
KEGG gene cross-reference	vg:940156 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.648

Rank 1 · TkA05G224020 · TK1151

Nucleus0.324

Rank 2 · TkA05G224020 · TK1151

Mitochondrion0.084

Rank 3 · TkA05G224020 · TK1151

Cell membrane0.063

Rank 4 · TkA05G224020 · TK1151

Endoplasmic reticulum0.037

Rank 5 · TkA05G224020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21024Peptidase_A3B107-158 aa

PF30863PRO_PEG10-RTL1170-191 aa

PF08284RVP_2198-281 aa

PF13650Asp_protease_2198-281 aa

PF13975gag-asp_proteas198-281 aa

PF02160Peptidase_A3204-372 aa

PF21024Peptidase_A3B206-256 aa

PF30863PRO_PEG10-RTL1206-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G224020	`PF21024`	Peptidase_A3B	107	158	0.028	15.9
TkA05G224020	`PF30863`	PRO_PEG10-RTL1	170	191	0.082	14.1
TkA05G224020	`PF08284`	RVP_2	198	281	0.0052	17.3
TkA05G224020	`PF13650`	Asp_protease_2	198	281	0.086	14.3
TkA05G224020	`PF13975`	gag-asp_proteas	198	281	0.12	13.7
TkA05G224020	`PF02160`	Peptidase_A3	204	372	1.7e-39	136.2
TkA05G224020	`PF21024`	Peptidase_A3B	206	256	0.028	15.9
TkA05G224020	`PF30863`	PRO_PEG10-RTL1	206	293	0.082	14.1
TkA05G224020	`PF30863`	PRO_PEG10-RTL1	333	353	0.082	14.1
TkA05G224020	`PF02160`	Peptidase_A3	424	463	1.7e-39	136.2
TkA05G224020	`PF00078`	RVT_1	443	598	6.7e-38	131.3
TkA05G224020	`PF21024`	Peptidase_A3B	528	562	0.028	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card