Gene Card
Gene overview
cDNA / CDS / Protein Sequences
955 bp · TkA05G213580|TK1151|cDNA
ATTTTTTTTTGTGTGTCATACTAAAAAAAAATTATGTCGTGTTCTATTTTCTACGAATCTCGTTCCTTTCCCTCTTCCCATACTAATTACTTTCAAAACCCTCTCCCCCTCTTCATTTCGTGACCCCAAACCCTAAACAGCCTCTCCACCATATTCAAAGCCGCTACCACCTCCACAAAAGAGATGAAAGAGATTTCATATGGTTTTATCATCGGGATCTCAGTAGGAGCGGTAATCGGAGCCCTCTTAGCCGTTAAATC...
318 bp · TkA05G213580|TK1151|CDS
ATGTTGAGGTACAAAGGTTCAAAACTTATATTGATAGATATAGCCAATGCAATTGATTTAGGAGATCGTTTTCTTCCAAAACTACAGCCTTTAAATTGTGAATTTTGGGCAGAAAGTAGCAACTTCATCTTGAGATATGAGAAAAGATCATGCTCAAACATCAAGGACACGCGACGGGGGATGAAGTTAAAGCCGAAGTGTTTCATCGATCATCTATTAGACGATAGGCATTTTTTTTATGTACAAGTATTATTATTCAG...
Protein
Download Protein FASTA105 aa · TkA05G213580|TK1151|PROTEIN
MLRYKGSKLILIDIANAIDLGDRFLPKLQPLNCEFWAESSNFILRYEKRSCSNIKDTRRGMKLKPKCFIDHLLDDRHFFYVQVLLFSDFTILYLTNNVLMYNKIY
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G213580 |
|---|---|
| TK1151 ID | TkA05G213580 |
| OH-1004 ID | LXL04_005710 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 85.700 |
| Protein coverage (%) | TK1151 26.667 / OH-1004 5.846Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G213580 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:53735580-53737286 (+) | ||||||||||||
| Description | Similar to CDC6B: Cell division control protein 6 homolog B | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000076 DNA replication checkpoint signaling Biological Process GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity Biological Process GO:0006270 DNA replication initiation Biological Process GO:0007089 traversing start control point of mitotic cell cycle Biological Process GO:0008156 negative regulation of DNA replication Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process GO:0032467 positive regulation of cytokinesis Biological Process GO:0033314 mitotic DNA replication checkpoint signaling Biological Process GO:0042023 DNA endoreduplication Biological Process GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity Biological Process GO:0048146 positive regulation of fibroblast proliferation Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT1G07270 ath:AT2G29680 dosa:Os01g0856000 hsa:990 mmu:23834 osa:4324832 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.