TkA05G187410 | RubberDandelionOmics

Gene overview

TkA05G187410

Reference: TK1151 Chr: Chr05 Coordinates: 47663050-47664344 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

600 bp · TkA05G187410|TK1151|cDNA

AGGTATACCAAGTACTTCCCTAATAACTTTATTAACAGTATCACTCTAAAGGATGCGATTGTGTCCATTTGTGATGAATTGGATGTGCCTTTACCAGAAAAAATCCGATTCTTCAGGTCACAAATGCAGACAATCATTACTAAAGCCTGCAAAGAGCTTGGTATAAAGCTGAGTCCTTGCAAACGGTGTCTGTCTCTTCTTCTTTGGCTGGAAGAACGTTATGAAACTATATATACTCGACATCCTGGTTTCCAGAAAGG...

CDS

Download CDS FASTA

600 bp · TkA05G187410|TK1151|CDS

AGGTATACCAAGTACTTCCCTAATAACTTTATTAACAGTATCACTCTAAAGGATGCGATTGTGTCCATTTGTGATGAATTGGATGTGCCTTTACCAGAAAAAATCCGATTCTTCAGGTCACAAATGCAGACAATCATTACTAAAGCCTGCAAAGAGCTTGGTATAAAGCTGAGTCCTTGCAAACGGTGTCTGTCTCTTCTTCTTTGGCTGGAAGAACGTTATGAAACTATATATACTCGACATCCTGGTTTCCAGAAAGG...

Protein

Download Protein FASTA

199 aa · TkA05G187410|TK1151|PROTEIN

RYTKYFPNNFINSITLKDAIVSICDELDVPLPEKIRFFRSQMQTIITKACKELGIKLSPCKRCLSLLLWLEERYETIYTRHPGFQKGSKPLLALDNPFPMELPDSLYGEKWAFVQLPFSDVMKELETLEKSFNFGATLDLDLLGIEFNDETLIPRLVVTSSRAQPLAAWMNVLEVCLIEADLARANLAAFSDQKEVATA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G187410`
TK1151 ID	TkA05G187410
OH-1004 ID	LXL04_020408
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	91.400
Protein coverage (%)	TK1151 93.970 / OH-1004 73.047 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G187410

Location Chr05:47663050-47664344 (-)

Description Similar to ATAB2: Protein TAB2 homolog, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08010`	Nuclear genome-encoded A/U-rich RNA-binding protein involved in the biogenesis of photosystem I (PSI) and II (PSII).	ATAB2 is a novel factor in the signalling pathway of light-controlled synthesis of photosystem proteins.2006 · DOI: 10.1038/sj.emboj.7601472

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0610800`	Nuclear genome-encoded factor involved in the biogenesis of photosystem I (PSI).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020408 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009704 de-etiolation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0048564 photosystem I assembly Biological Process

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0004435 phosphatidylinositol-4,5-bisphosphate phospholipase C activity Molecular Function

KEGG gene cross-reference

ath:AT3G08010

dosa:Os02g0610800

zma:100284484

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.410

Rank 1 · TkA05G187410 · TK1151

Nucleus0.263

Rank 2 · TkA05G187410 · TK1151

Plastid0.171

Rank 3 · TkA05G187410 · TK1151

Mitochondrion0.139

Rank 4 · TkA05G187410 · TK1151

Endoplasmic reticulum0.071

Rank 5 · TkA05G187410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06485Tab2-like_N1-73 aa

PF22007DUF693019-58 aa

PF20429Tab2-like_C90-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G187410	`PF06485`	Tab2-like_N	1	73	6.7e-18	65.3
TkA05G187410	`PF22007`	DUF6930	19	58	0.031	15.2
TkA05G187410	`PF20429`	Tab2-like_C	90	187	3.8e-20	73.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFB3`	Arabidopsis thaliana	sp\|Q9SFB3\|ATAB2_ARATH Protein TAB2 homolog, chloroplastic	73.500%	Swiss-Prot	High
`Q6K9C1`	Oryza sativa subsp. japonica	sp\|Q6K9C1\|ATAB2_ORYSJ Protein TAB2 homolog, chloroplastic	65.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card