Gene Card
Gene overview
cDNA / CDS / Protein Sequences
709 bp · TkA05G186030|TK1151|cDNA
CAGCACATCCTCAAGTATCTACCAGAGCTGCTTTCTTTAATAGCACAACTATGGTCATCATTCAGTCTCCCAACAGCTAACCGCTCCGGTAAAAAAAGAAGATTGGGCAGAATGGATGAGACATTTCAGCATTGAACTACACAAAGAATCACCTTCTCCAGCTTAAGAACATGTGCCAGGCTGGCAGTGTCGCTAACTTTTAATTTCTGTTTGCCTTTTTTTATTAACTTCAGTTGTAACCGTACTTTTTATTCCAGCCA...
324 bp · TkA05G186030|TK1151|CDS
ATGGAAGATGATGAGAAGTGTCGAGCATTTGCCAAGGCATTGCATTATAAAGAGATGGAATTTGAAGGTGCACTTTTCAAGAAGATGGATGCAAACCCTGTTGCTGTAGTGAAGCACTCATTCATATTAATAATCAGTTACATCAGCATGAGGCTTACTCACGTCACCGGGAATGTTGCAGGACGGGCACGGTCAAGTAGGGTCAAGGCTGGGAGGAAAGTGGGACAGTCGTTTGAAACTTTGAATGCAAAGGTCACAGG...
Protein
Download Protein FASTA107 aa · TkA05G186030|TK1151|PROTEIN
MEDDEKCRAFAKALHYKEMEFEGALFKKMDANPVAVVKHSFILIISYISMRLTHVTGNVAGRARSSRVKAGRKVGQSFETLNAKVTGLRLKEVQHWNPFLENWKWTI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G186030 |
|---|---|
| TK1151 ID | TkA05G186030 |
| OH-1004 ID | LXL04_007334 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 94.100 |
| Protein coverage (%) | TK1151 31.776 / OH-1004 1.345Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G186030 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:47333662-47335176 (+) | ||||||||||||
| Description | Similar to TOR: Serine/threonine-protein kinase TOR | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0001558 regulation of cell growth Biological Process GO:0006935 chemotaxis Biological Process GO:0006952 defense response Biological Process GO:0007584 response to nutrient Biological Process GO:0009267 cellular response to starvation Biological Process GO:0009303 rRNA transcription Biological Process GO:0009615 response to virus Biological Process GO:0009630 gravitropism Biological Process GO:0009688 abscisic acid biosynthetic process Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT1G50030 ddi:DDB_G0281569 dosa:Os05g0235300 spo:2540473 spo:2540720 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.