RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G171710
Reference: TK1151 Chr: Chr05 Coordinates: 44016178-44017568 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

618 bp · TkA05G171710|TK1151|cDNA

ATGCTTTCACTCGGATTGCATCTTGCCCCACACACGGATCGCCATCTTGGCATCTCCTTCCCTCCCACTCCGTTGTACCTCAGATGGGTTTGTAAATTTGAATTTAATGGGTTTGTAAATTTACAACCAACCTTTTCAACCCCACTGGCCAAACCCCCGCCCCCGTCGGTCGTCGAACTCGAACCCATTTCCTCAGTCGTCTCCCTCGCTCGATCTGTAATCCATCACCACTGCCACCGTTTATCTCTACCGCTTCTACA...

CDS

Download CDS FASTA

618 bp · TkA05G171710|TK1151|CDS

ATGCTTTCACTCGGATTGCATCTTGCCCCACACACGGATCGCCATCTTGGCATCTCCTTCCCTCCCACTCCGTTGTACCTCAGATGGGTTTGTAAATTTGAATTTAATGGGTTTGTAAATTTACAACCAACCTTTTCAACCCCACTGGCCAAACCCCCGCCCCCGTCGGTCGTCGAACTCGAACCCATTTCCTCAGTCGTCTCCCTCGCTCGATCTGTAATCCATCACCACTGCCACCGTTTATCTCTACCGCTTCTACA...

Protein

Download Protein FASTA

205 aa · TkA05G171710|TK1151|PROTEIN

MLSLGLHLAPHTDRHLGISFPPTPLYLRWVCKFEFNGFVNLQPTFSTPLAKPPPPSVVELEPISSVVSLARSVIHHHCHRLSLPLLQSTLLHRFMHYRSRVERTRSRQHSAKRSSGNRKPVRLWWKRIFRLKKRMRRRNSGLLRIQECNVMDTLIKKPICLLNTVFKDDYKHPNCYGIFLLFILIHLNSLKLHCLRMIVLDYETG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G171710
TK1151 IDTkA05G171710
OH-1004 IDLXL04_007130
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)79.800
Protein coverage (%)TK1151 51.220 / OH-1004 24.892
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G171710
LocationChr05:44016178-44017568 (-)
DescriptionSimilar to SFH12: Phosphatidylinositol/phosphatidylcholine transfer protein SFH12
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_007130 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006656 phosphatidylcholine biosynthetic process Biological Process
GO:0006892 post-Golgi vesicle-mediated transport Biological Process
GO:0009908 flower development Biological Process
GO:0015031 protein transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0008526 phosphatidylinositol transfer activity Molecular Function
KEGG gene cross-reference
ath:AT1G75370
ath:AT2G18180
ath:AT2G21540
ath:AT4G36490
ath:AT4G39180
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.516
Rank 1 · TkA05G171710 · TK1151
Cytoplasm0.321
Rank 2 · TkA05G171710 · TK1151
Cell membrane0.118
Rank 3 · TkA05G171710 · TK1151
Mitochondrion0.088
Rank 4 · TkA05G171710 · TK1151
Endoplasmic reticulum0.087
Rank 5 · TkA05G171710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser