TkA05G169840 | RubberDandelionOmics

Gene overview

TkA05G169840

Reference: TK1151 Chr: Chr05 Coordinates: 43610877-43611726 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

414 bp · TkA05G169840|TK1151|cDNA

ATGGGCATTTTCGTCCAGAAGCAACAGGCAAGACGCAAATTCAAAATTCTTCAAGACAAACAGGTGCTTAACTGTTTTGAGCAGTTCTGCATTAATCTGACTAATGAGAAACTTCAGCAACATTTCAATCAGCATGTATTCAAGATGGAACAAGAAGAATATACACGGGAGGAAATAGACTGGAGTTACATACAGTTTGAGGACAATCAAGACATTTTAGATCTGATTGAAAAGGTCTTTATTTATGGTTTAGGCTTTCT...

CDS

Download CDS FASTA

414 bp · TkA05G169840|TK1151|CDS

ATGGGCATTTTCGTCCAGAAGCAACAGGCAAGACGCAAATTCAAAATTCTTCAAGACAAACAGGTGCTTAACTGTTTTGAGCAGTTCTGCATTAATCTGACTAATGAGAAACTTCAGCAACATTTCAATCAGCATGTATTCAAGATGGAACAAGAAGAATATACACGGGAGGAAATAGACTGGAGTTACATACAGTTTGAGGACAATCAAGACATTTTAGATCTGATTGAAAAGGTCTTTATTTATGGTTTAGGCTTTCT...

Protein

Download Protein FASTA

137 aa · TkA05G169840|TK1151|PROTEIN

MGIFVQKQQARRKFKILQDKQVLNCFEQFCINLTNEKLQQHFNQHVFKMEQEEYTREEIDWSYIQFEDNQDILDLIEKVFIYGLGFLSRTCMEQWYVHAHACMDMEASWNDSMGAKTVYDQLRPSGIEDRMVGEQVG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G169840`
TK1151 ID	TkA05G169840
OH-1004 ID	LXL04_028851
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	67.000
Protein coverage (%)	TK1151 67.153 / OH-1004 37.455 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G169840

Location Chr05:43610877-43611726 (+)

Description Similar to XI-B: Myosin-8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04600`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At2g33240`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At4g28710`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At2g31900`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g04160`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028851 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0030048 actin filament-based movement Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048767 root hair elongation Biological Process

GO:0051645 Golgi localization Biological Process

GO:0051646 mitochondrion localization Biological Process

GO:0060151 peroxisome localization Biological Process

GO:0090436 leaf pavement cell development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT1G04160

ath:AT1G04600

ath:AT2G33240

ath:AT4G28710

ath:AT5G43900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.483

Rank 1 · TkA05G169840 · TK1151

Cytoplasm0.445

Rank 2 · TkA05G169840 · TK1151

Mitochondrion0.118

Rank 3 · TkA05G169840 · TK1151

Cell membrane0.053

Rank 4 · TkA05G169840 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA05G169840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31194RTT101_N7-82 aa

PF00063Myosin_head23-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G169840	`PF31194`	RTT101_N	7	82	0.00056	20.5
TkA05G169840	`PF00063`	Myosin_head	23	92	2.4e-25	89.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I5Q6`	Arabidopsis thaliana	sp\|F4I5Q6\|MYO7_ARATH Myosin-7	76.800%	Swiss-Prot	Medium
`F4IVR7`	Arabidopsis thaliana	sp\|F4IVR7\|MYO10_ARATH Myosin-10	76.800%	Swiss-Prot	Medium
`F4JM19`	Arabidopsis thaliana	sp\|F4JM19\|MYO14_ARATH Myosin-14	61.400%	Swiss-Prot	Medium
`F4IRU3`	Arabidopsis thaliana	sp\|F4IRU3\|MYO12_ARATH Myosin-12	72.900%	Swiss-Prot	Medium
`F4I460`	Arabidopsis thaliana	sp\|F4I460\|MYO8_ARATH Myosin-8	75.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card